Paenarthrobacter sp. YJN-5: HMI59_08105 Help Entry HMI59_08105       CDS       T10115                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism payj  Paenarthrobacter sp. YJN-5 Pathway payj00190   Oxidative phosphorylation payj01100   Metabolic pathways Module payj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:payj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HMI59_08105 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:payj00194]     HMI59_08105 (atpE) Photosynthesis proteins [BR:payj00194]  Photosystem and electron transport system   F-type ATPase [OT]    HMI59_08105 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF4233 Motif Other DBs NCBI-ProteinID:  QOT16571 UniProt:  A0A7M2C113 LinkDB All DBs Position 1702511..1702714 Genome browser AA seq 67 aa AA seqDB search MEGNLNLVGYGLSAIGGGIGVGLVFAAYINGVARQPEAQRVLQPIAFLGLALTEALAILG LVFAFVL NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggaaggcaatctcaacctcgtaggttacggtctgtccgcaatcggcggtggtatcggt gtgggtctcgtgttcgcggcttacatcaacggtgttgctcgtcagccggaagctcagcgc gtgctgcagccgatcgcattccttggtctggcactgaccgaagctcttgccatcctcggc ctcgtcttcgctttcgttctctag

DBGET integrated database retrieval system