Paenarthrobacter sp. YJN-5: HMI59_12250 Help Entry HMI59_12250       CDS       T10115                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism payj  Paenarthrobacter sp. YJN-5 Pathway payj01100   Metabolic pathways payj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:payj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HMI59_12250    00074 Mycolic acid biosynthesis     HMI59_12250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HMI59_12250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QOT17300 LinkDB All DBs Position complement(2590260..2590514) Genome browser AA seq 84 aa AA seqDB search MTHDEARDAVQAALGVVAPDIDLDEVEGRSRLRQDLELDSLDFLRLVETLDVQTGVNIPE SDYPKVGTVDGLIDYLASAGAGDR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacccacgatgaagcacgcgatgccgtccaagccgccttgggcgtggttgctccggac atagacctggacgaggtcgaaggccgatcccgtcttcgacaggatcttgagctggattcc ctcgatttcctgaggttggtggaaaccttggacgttcagacaggggtcaacattccggaa agcgactatcccaaagtgggtaccgtggacgggctcatcgactatctcgcctccgccggt gcaggggaccgctag

DBGET integrated database retrieval system