Paenarthrobacter sp. YJN-D: HMI60_18145 Help Entry HMI60_18145       CDS       T10599                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism payn  Paenarthrobacter sp. YJN-D Brite KEGG Orthology (KO) [BR:payn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:payn03032]     HMI60_18145    03036 Chromosome and associated proteins [BR:payn03036]     HMI60_18145    03400 DNA repair and recombination proteins [BR:payn03400]     HMI60_18145 DNA replication proteins [BR:payn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HMI60_18145 Chromosome and associated proteins [BR:payn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HMI60_18145 DNA repair and recombination proteins [BR:payn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HMI60_18145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QOT23299 LinkDB All DBs Position complement(3911313..3911600) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaactcgttgcagaggtagcaggcaaggctggcaccagccag gcagcagtcaactccgtgctcgatgcactgttcgaagttttcgagacttctgtcgccgcc ggcgagaagatcaccatcccgggctggctcgccgttgagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggcgaaaccatccagatcgcagccggccacagcgtcaag ctgaccgctggctccaagctgaaggcagctgtcgccaagaagaagtaa

DBGET integrated database retrieval system