Pseudomonas azerbaijanorientalis: KSS91_06410 Help Entry KSS91_06410       CDS       T07706                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism paze  Pseudomonas azerbaijanorientalis Brite KEGG Orthology (KO) [BR:paze00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:paze03036]     KSS91_06410 (ftsB) Chromosome and associated proteins [BR:paze03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KSS91_06410 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC YabA ZapB Csm1_N XRCC4_CC Motif Other DBs NCBI-ProteinID:  QXH63118 LinkDB All DBs Position 1479211..1479489 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLILLLLLAGLQYRLWVGNGSLAQVAELTQQIADQQAENQALLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcattctgcttttgttgctggctggcttgcagtac cgcctgtgggtgggaaacggcagtctggcgcaagtggccgagttgacgcagcagatcgcg gatcagcaagctgagaaccaggcattgctggagcgcaatcgggtaatggacgccgaagtc agtgagttgaaaaagggtatggagaccgttgaagagcgggctcgccatgagctgggcatg gtcaaggacggtgaaaccctttaccagttggcgcaatga

DBGET integrated database retrieval system