KEGG   Pseudomonas azerbaijanorientalis: KSS91_17480
Entry
KSS91_17480       CDS       T07706                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
paze  Pseudomonas azerbaijanorientalis
Pathway
paze02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paze00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KSS91_17480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paze02000]
    KSS91_17480
Enzymes [BR:paze01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     KSS91_17480
Transporters [BR:paze02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    KSS91_17480
SSDB
Motif
Pfam: ABC_tran AAA_29 AAA_21 RsgA_GTPase AAA_16 nSTAND1 AAA_28 MMR_HSR1 AAA_22 AAA_25 AAA_23 AAA_30 AAA_5 AAA_7 SMC_N NACHT FtsK_SpoIIIE Dynamin_N Cytidylate_kin nSTAND3 RNA_helicase
Other DBs
NCBI-ProteinID: QXH59921
LinkDB
Position
3948346..3949143
AA seq 265 aa
MTLHLNRVSLTHDTGVRALHEVDLHISAGEQVAIIGPSGAGKSSLLNLLATALRPGSGTV
EVLGEQAWQLGARKRQRLRARIGLVHQAPPLPPRQRVVTAVLAGKLGQWGFAKSLLSLLH
PVDVPGARAALVKLDLGDKLFAQCQQLSGGQLQRVGIARVLYQAPDVLLADEPVSAMDPV
LAGHTLSILCRHAREHKVTLVASLHAVDLALSNFSRIIGLRDGQILFDLPAADVDQDLLD
RLYANEQLQSPPAPVAPLSLQIPRC
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaccctgcatctgaaccgggtcagcctcacccacgacacgggcgtgcgggcgctgcat
gaggtcgacctgcacatcagcgccggtgagcaggtggcgatcatcggcccctccggcgcc
ggcaagtcgagcctgctgaacctgctggccaccgccctgcgccccggcagcggcacggtc
gaagtgctcggcgagcaagcctggcagctcggcgcccgaaagcgccaacgcctgcgcgcg
cgcatcggcctggtgcatcaggcgccgccgctgccaccgcgccagcgcgtggtcacggcg
gtgctggccggcaagctggggcaatggggttttgccaaaagcctgctgagcctgttgcat
ccggtggatgtgcccggtgcacgcgcggccctggttaaactcgaccttggcgacaaactg
ttcgcccagtgccagcaattatccggtggccaactgcagcgcgtgggcattgcccgcgtg
ctgtaccaggcccccgacgtgctgctggccgatgagccggtgtcggcgatggacccggtg
ctggccgggcacaccctgtcgatcctctgccgccacgcccgggaacacaaggtgaccctg
gtcgccagcctgcatgcggtggatctggcgctgagcaacttctcgcgcatcatcggtttg
cgcgacggccagatcctcttcgatcttcccgctgccgacgtcgaccaggatttgctcgac
cggctctacgccaacgagcaactgcaatccccgcccgctccggtggcgcccttgagcctg
cagattccccgatgctga

DBGET integrated database retrieval system