Pseudomonas azerbaijanorientalis: KSS91_17480
Help
Entry
KSS91_17480 CDS
T07706
Name
(GenBank) ATP-binding cassette domain-containing protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
paze
Pseudomonas azerbaijanorientalis
Pathway
paze02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
paze00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
KSS91_17480
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
paze02000
]
KSS91_17480
Enzymes [BR:
paze01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
KSS91_17480
Transporters [BR:
paze02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
KSS91_17480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_29
AAA_21
RsgA_GTPase
AAA_16
nSTAND1
AAA_28
MMR_HSR1
AAA_22
AAA_25
AAA_23
AAA_30
AAA_5
AAA_7
SMC_N
NACHT
FtsK_SpoIIIE
Dynamin_N
Cytidylate_kin
nSTAND3
RNA_helicase
Motif
Other DBs
NCBI-ProteinID:
QXH59921
LinkDB
All DBs
Position
3948346..3949143
Genome browser
AA seq
265 aa
AA seq
DB search
MTLHLNRVSLTHDTGVRALHEVDLHISAGEQVAIIGPSGAGKSSLLNLLATALRPGSGTV
EVLGEQAWQLGARKRQRLRARIGLVHQAPPLPPRQRVVTAVLAGKLGQWGFAKSLLSLLH
PVDVPGARAALVKLDLGDKLFAQCQQLSGGQLQRVGIARVLYQAPDVLLADEPVSAMDPV
LAGHTLSILCRHAREHKVTLVASLHAVDLALSNFSRIIGLRDGQILFDLPAADVDQDLLD
RLYANEQLQSPPAPVAPLSLQIPRC
NT seq
798 nt
NT seq
+upstream
nt +downstream
nt
atgaccctgcatctgaaccgggtcagcctcacccacgacacgggcgtgcgggcgctgcat
gaggtcgacctgcacatcagcgccggtgagcaggtggcgatcatcggcccctccggcgcc
ggcaagtcgagcctgctgaacctgctggccaccgccctgcgccccggcagcggcacggtc
gaagtgctcggcgagcaagcctggcagctcggcgcccgaaagcgccaacgcctgcgcgcg
cgcatcggcctggtgcatcaggcgccgccgctgccaccgcgccagcgcgtggtcacggcg
gtgctggccggcaagctggggcaatggggttttgccaaaagcctgctgagcctgttgcat
ccggtggatgtgcccggtgcacgcgcggccctggttaaactcgaccttggcgacaaactg
ttcgcccagtgccagcaattatccggtggccaactgcagcgcgtgggcattgcccgcgtg
ctgtaccaggcccccgacgtgctgctggccgatgagccggtgtcggcgatggacccggtg
ctggccgggcacaccctgtcgatcctctgccgccacgcccgggaacacaaggtgaccctg
gtcgccagcctgcatgcggtggatctggcgctgagcaacttctcgcgcatcatcggtttg
cgcgacggccagatcctcttcgatcttcccgctgccgacgtcgaccaggatttgctcgac
cggctctacgccaacgagcaactgcaatccccgcccgctccggtggcgcccttgagcctg
cagattccccgatgctga
DBGET
integrated database retrieval system