Pseudomonas azotoformans: AYR47_05585 Help Entry AYR47_05585       CDS       T04879                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pazo  Pseudomonas azotoformans Brite KEGG Orthology (KO) [BR:pazo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pazo03036]     AYR47_05585 Chromosome and associated proteins [BR:pazo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AYR47_05585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP TPR_MLP1_2 VGPC1_C Macoilin Motif Other DBs NCBI-ProteinID:  AMN77835 UniProt:  A0A127HTI1 LinkDB All DBs Position 1173742..1173951 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaattgctaattacccgggtc gagcaactaaagagtcaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system