Pseudomonas azotoformans: AYR47_09375 Help Entry AYR47_09375       CDS       T04879                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pazo  Pseudomonas azotoformans Pathway pazo01100   Metabolic pathways pazo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pazo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYR47_09375    00074 Mycolic acid biosynthesis     AYR47_09375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYR47_09375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMN78518 UniProt:  A0A127HVG1 LinkDB All DBs Position complement(2015510..2015779) Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKTLIIEALGLEDISVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcagtgtcgacgacatcggcagcgagcagaccctgttcggcgaaggcctc ggcctggattcggtagacgccctggaattgggcctggcgatccagaaaaagtacggtatc aagatcgatgccgacgccaaggacacccgcaatcacttcaccaacgtggccagccttgcg gcgttcgtcacggccagacaggcagcttga

DBGET integrated database retrieval system