Pseudomonas azotoformans: AYR47_26470 Help Entry AYR47_26470       CDS       T04879                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pazo  Pseudomonas azotoformans Brite KEGG Orthology (KO) [BR:pazo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pazo03032]     AYR47_26470    03036 Chromosome and associated proteins [BR:pazo03036]     AYR47_26470    03400 DNA repair and recombination proteins [BR:pazo03400]     AYR47_26470 DNA replication proteins [BR:pazo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AYR47_26470 Chromosome and associated proteins [BR:pazo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AYR47_26470 DNA repair and recombination proteins [BR:pazo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AYR47_26470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Barstar Motif Other DBs NCBI-ProteinID:  AMN81638 UniProt:  A0A127I462 LinkDB All DBs Position complement(5775675..5775947) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARTG RNPQTGKALQIAAAKKPGFKAGKALKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgattgatgctatcgctgcatccgctgatatcccgaaagctgct gctggccgtgcgctggatgcagtaatcgaatccgtcactggcgctctgaaggccggcgac tccgtggtcctggtaggcttcggtactttctctgtgactgaccgcccagctcgcactggc cgtaacccacagactggcaaagcactgcagatcgctgctgccaagaaaccaggtttcaaa gccggtaaagccctgaaagaagctgttaactaa

DBGET integrated database retrieval system