Pseudomonas azotoformans: AYR47_30320 Help Entry AYR47_30320       CDS       T04879                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pazo  Pseudomonas azotoformans Pathway pazo01100   Metabolic pathways pazo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pazo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYR47_30320    00074 Mycolic acid biosynthesis     AYR47_30320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYR47_30320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AMN82336 UniProt:  A0A127I654 LinkDB All DBs Position complement(6593228..6593464) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system