Paraburkholderia sp. 22B1P: PBP221_01190 Help Entry PBP221_01190      CDS       T10680                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pazz  Paraburkholderia sp. 22B1P Brite KEGG Orthology (KO) [BR:pazz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pazz03036]     PBP221_01190    03400 DNA repair and recombination proteins [BR:pazz03400]     PBP221_01190 Chromosome and associated proteins [BR:pazz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     PBP221_01190 DNA repair and recombination proteins [BR:pazz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       PBP221_01190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE DUF4878 Motif Other DBs NCBI-ProteinID:  BEU19979 LinkDB All DBs Position 1:135650..135955 Genome browser AA seq 101 aa AA seqDB search MSSYRELLAQREKLEKQIEEAKAREYAEVLNEIKQKMSDYGITLAELGAGGRTKAVKAAG RPRAGVAPKYRDPESGSTWSGRGKPPRWIAGQDREKFLIEK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtcctcctacagggaactactcgcgcagcgcgaaaagctcgagaaacagatcgaagag gcgaaagcgcgcgagtatgcggaagtgttaaacgagatcaagcagaaaatgtctgattac ggtattacgctggctgaactcggcgctggcggacgtacgaaagctgtaaaggcagcgggc cgtccccgcgccggcgtcgcgcctaaatatcgtgaccccgaaagcggcagcacctggtcg ggccgcggtaagccgccccgctggattgccggtcaagatcgcgaaaaatttctcatcgag aaataa

DBGET integrated database retrieval system