Paraburkholderia sp. 22B1P: PBP221_08970 Help Entry PBP221_08970      CDS       T10680                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pazz  Paraburkholderia sp. 22B1P Pathway pazz00998   Biosynthesis of various antibiotics pazz01100   Metabolic pathways pazz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pazz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PBP221_08970 (acpP)    00074 Mycolic acid biosynthesis     PBP221_08970 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PBP221_08970 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  BEU20757 LinkDB All DBs Position 1:1009344..1009583 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgttgcagaacaactcggtgttgccgaa gcggaaatcaagaacgaagcatcgttcgtgaacgacctcggcgctgactcgctcgacacg gtcgagctggtgatggctctcgaagacgaattcggcatggaaattccggatgaagaagcc gaaaagatcacgacggttcagcaagcgatcgactacgctcgcgctaacgtcaaggcctaa

DBGET integrated database retrieval system