Paraburkholderia sp. 22B1P: PBP221_16860 Help Entry PBP221_16860      CDS       T10680                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pazz  Paraburkholderia sp. 22B1P Brite KEGG Orthology (KO) [BR:pazz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pazz03032]     PBP221_16860    03036 Chromosome and associated proteins [BR:pazz03036]     PBP221_16860    03400 DNA repair and recombination proteins [BR:pazz03400]     PBP221_16860 DNA replication proteins [BR:pazz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PBP221_16860 Chromosome and associated proteins [BR:pazz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PBP221_16860 DNA repair and recombination proteins [BR:pazz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PBP221_16860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  BEU21546 LinkDB All DBs Position 1:complement(1938671..1938976) Genome browser AA seq 101 aa AA seqDB search MIAQLHSRGLGMNKTELIDHIAQQADISKAAAGRALDAVIGGVKGTLKKGGSVTLVGFGT FAVGKRTARTGRNPRTGAAIKIKAAKVPKFRPGKALKDALN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgattgcccaactacattctcgggggcttggaatgaataaaacggaattgatcgatcac atcgcgcagcaagccgacatttcgaaagcggcagcaggtcgcgcgttggatgccgtgatc ggtggcgtcaaaggcacgttgaaaaaaggtggttcggtgacgctggtcggcttcggcacg ttcgccgttggcaagcgcacggcacgcacgggccgcaatccgcgcacgggcgcagcaatc aagatcaaggcagccaaggttcctaaatttaggcctggtaaagcgctaaaggatgcgtta aactaa

DBGET integrated database retrieval system