KEGG   Paraburkholderia sp. 22B1P: PBP221_31340
Entry
PBP221_31340      CDS       T10680                                 
Symbol
fliI
Name
(GenBank) flagellar protein export ATPase FliI
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
pazz  Paraburkholderia sp. 22B1P
Pathway
pazz02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:pazz00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PBP221_31340 (fliI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pazz02044]
    PBP221_31340 (fliI)
   02035 Bacterial motility proteins [BR:pazz02035]
    PBP221_31340 (fliI)
Enzymes [BR:pazz01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PBP221_31340 (fliI)
Secretion system [BR:pazz02044]
 Type III secretion system
  Flagellar export apparatus
   PBP221_31340 (fliI)
Bacterial motility proteins [BR:pazz02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    PBP221_31340 (fliI)
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ABC_tran AAA_16 Importin_rep_6
Other DBs
NCBI-ProteinID: BEU22994
LinkDB
Position
1:3586484..3588139
AA seq 551 aa
MVKPTIEDIQHSDLTPLERELALASFGAEALTVAQMEESLAALESAISDAHSAGQSRDET
RDDTNDDASGAHPAAAPASRESAAAQKRAPDPALASNPHLQAWRNRLNGLRERNQIARPL
RACGRLTRAAGLVLEAVGLRLAVGSEVMIELPPGSSRTMAEAEVVGFHGDKLFLMPTTEV
AGLLPGARVYPLEVAPIADPMAGAKRLPVGWELLGRVVDASGKPLDGFGPLNARNDAPLT
APTINPLHREPIHKVLDVGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGTMARYTNAEV
IVIGLIGERGREVKEFIEQILGEEGLARSVVVAAPADVSPLLRMQAAAYTTSLAEYFRDQ
GKHVLLLMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTGNGPEGGGSIT
AFYTVLTEGDDQQDPIADSARAILDGHIVLSRALAEAGHYPAIDIEASISRAMTSLISDA
HLDRTRQFKQMLSRYQRNRDLINVGAYSSGRDAVLDKAIALYPRMEAFLQQGFRESAGFD
ASIAHLDSLFG
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggtaaagccaaccatcgaagacattcagcacagcgacctcacgccgctcgagcgcgaa
ctggcgctggcgtcgttcggcgcggaagcgctcaccgtcgcgcagatggaagagtcgctc
gcggcgctggaatccgcgatttctgacgcgcattcggcgggccaatcccgcgatgaaacc
cgcgacgacacaaacgacgacgccagcggcgcacatcccgctgctgcgcccgcgagccgc
gaatcggcggctgcgcaaaagcgcgcgcccgatcccgcacttgcatccaatccgcatctg
caggcgtggcgcaatcgtttgaatggtctgcgcgagcgcaaccagatcgcgcgcccgctg
cgcgcctgtggccgcctgacgcgcgccgccggtctggtgctcgaagccgtcggcctgcgt
ctggccgtcggttcggaagtgatgatcgaactgccgcccggcagctcgcgcaccatggcg
gaagccgaagtggtcggctttcacggcgacaagctctttctgatgccgaccacggaagtc
gccggtctgctgcccggcgcgcgtgtctatccgctggaagtcgcgccgatcgccgatccg
atggcgggcgcgaagcgtctgcccgtgggctgggaactgctcggccgcgtggtcgatgca
tcgggcaagccgctcgacggcttcggcccgctcaacgcgcgcaacgacgcgccgctcacc
gcgccgaccatcaacccgttgcatcgcgagccgattcacaaggtgctcgacgtcggcgtg
cgcgcaatcaacgcgctgctcaccgtcggacgcggccagcgcatggggctgttcgccggt
tcgggcgtcggtaaatcggtgctgctcggcacgatggcgcgctacaccaacgccgaagtg
atcgtgatcggcctgatcggcgaacgtggccgcgaagtgaaggaattcatcgagcagatt
ctcggcgaggaaggtctcgcgcgctccgtcgtcgtggccgcgcccgccgacgtgtcgccg
ctgttgcggatgcaggccgccgcctacacgacctcgctcgccgaatatttccgcgaccag
ggcaagcacgttctgttgctgatggactcgctcacgcgttacgcgatggcgcagcgcgag
atcgcgctggcgatcggcgaaccgcccgcgaccaagggttatccgccttccgtgttcgcc
aagctgcccgcgctcgtcgagcgcacgggcaacggcccggaaggcggcggttcgattacc
gcgttctatacggtgctgacggaaggcgacgaccagcaggacccgatcgccgattcggcg
cgcgcgattctcgacggccatatcgtgctgtcgcgcgcgctcgccgaagcgggccactat
cctgccatcgacatcgaagcgtcgatcagccgcgcgatgacctcgctcatcagcgacgcg
catctcgatcgcacgcggcagttcaagcagatgctgtcgcgctaccagcgcaaccgcgat
ctgatcaacgtcggcgcgtattcgtcgggacgcgacgcggtgctcgacaaggccatcgcg
ctgtatccgcgcatggaagcgttcctgcagcaaggtttccgcgaaagtgcgggcttcgac
gccagcatcgcgcacctcgattcgctgttcggctag

DBGET integrated database retrieval system