Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a779
Help
Entry
PSEBR_a779 CDS
T01472
Name
(GenBank) tRNA pseudouridine synthase B; TruB family pseudouridylate synthase (N terminal domain)
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
pba
Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
KEGG Orthology (KO) [BR:
pba00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
pba03016
]
PSEBR_a779
Enzymes [BR:
pba01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
PSEBR_a779
Transfer RNA biogenesis [BR:
pba03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
PSEBR_a779
Prokaryotic type
PSEBR_a779
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
TruB-C_2
PUA_3
Motif
Other DBs
NCBI-ProteinID:
AEA66943
UniProt:
F2K867
LinkDB
All DBs
Position
1008459..1009376
Genome browser
AA seq
305 aa
AA seq
DB search
MAQVKRIRRNVSGIILLDKPLGFTSNAALQKVRWLLNAEKAGHTGSLDPLATGVLPLCFG
EATKFSQYLLDSDKGYETLAQLGKTTTTADAEGEVLLERPVTVGQADIEAVLPAFRGQIS
QIPPMYSALKRDGQPLYKLARAGEVVEREPRSVTIARLELLAFDGNTARLAVDCSKGTYI
RTLVEDIGEQLGCGAYVAELRRTQAGPFTLAQTVTLEELEAVHAEGGNEAVDRFLMPSDS
GLLDWPLLQFSEHSAFYWLNGQPVRAPDAPKFGMVRVQDHNGRFIGIGEVSEDGRIAPRR
LIRSE
NT seq
918 nt
NT seq
+upstream
nt +downstream
nt
gtggctcaggtcaaacgtatccgtcgtaacgtcagcggtatcatcctgctcgacaagccg
ctggggttcacgtccaacgcggcgttgcagaaggttcgctggctgctcaatgccgaaaag
gccgggcataccggtagcctcgatccgctggccaccggcgtgctgccgctgtgctttggc
gaggcgaccaaattttcccagtacctgctcgattccgacaagggctatgaaaccctggcg
caactgggcaagaccaccaccacggcggatgccgaaggtgaggttttgctcgagcgcccg
gtgaccgttggtcaggctgatatcgaagccgtgctgccagcttttcgtgggcaaatcagt
cagataccgccgatgtactcggctctgaagcgtgatggccagcccttgtataaactggcc
cgggcaggcgaagtagtggagcgcgagccgcgttctgttactattgcgcgcttggaattg
ctggcctttgacggtaatactgcgcggctggccgtggattgcagcaagggcacctatatc
cggactctggtggaggatattggtgaacagctcggctgtggcgcgtacgtggcagaattg
cgacggacccaggccgggcctttcacgttggcccagacggtcacgctggaagagcttgaa
gcggtacatgccgaaggcggcaacgaagcggtcgaccgtttcctgatgccatcggacagc
ggcttgctggattggccgctgttgcagttctcggaacacagtgcgttttactggctcaac
ggccagccggtacgtgccccggatgcgccgaagttcggcatggtccgggtgcaggatcat
aacggtcgcttcatcggtatcggtgaagtgagcgaagacgggcgtattgcgccgcgtcga
ctgattcggtcggaatga
DBGET
integrated database retrieval system