KEGG   Paenibacillus barcinonensis: HUB98_13180
Entry
HUB98_13180       CDS       T06922                                 
Symbol
mmuM
Name
(GenBank) homocysteine S-methyltransferase
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
pbac  Paenibacillus barcinonensis
Pathway
pbac00270  Cysteine and methionine metabolism
pbac00670  One carbon pool by folate
pbac01100  Metabolic pathways
pbac01110  Biosynthesis of secondary metabolites
pbac04981  Folate transport and metabolism
Brite
KEGG Orthology (KO) [BR:pbac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HUB98_13180 (mmuM)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HUB98_13180 (mmuM)
 09150 Organismal Systems
  09154 Digestive system
   04981 Folate transport and metabolism
    HUB98_13180 (mmuM)
Enzymes [BR:pbac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     HUB98_13180 (mmuM)
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-ProteinID: QKS57173
UniProt: A0A2V4URK1
LinkDB
Position
complement(2842200..2843183)
AA seq 327 aa
MIQREQTNDINVIQRILHEYPLMILDGALATELEQHGCDLDDPLWSARVLLENPDVIVQV
HADYFRAGADCAITSSYQATVEGFRKRGIGEQAALELIRKTVELAAKARDDVWAEVRNTA
DHVDGPLRRPRPIVAGSVGPYGAYLADGSEYVGHYGVSDETLAAFHRPRIAALVEAGADV
LALETIPSLQEARVLVELLKEFPETSAWLSFSLKDGTSISEGTPLEVCAQAFGSEPQLAA
IGLNCAPMEVVTEAIGILRSSSDKPVIVYPNSGETYDAETKTWSGQGSCGSMKDASEQWV
AAGARIIGGCCRTTPHQISELARKWRG
NT seq 984 nt   +upstreamnt  +downstreamnt
atgattcaacgtgagcaaacgaatgatattaatgtaattcaacgtattctgcacgagtat
ccactgatgattctggatggtgcactagccacggagcttgagcagcatggctgtgatctg
gatgaccccctctggtctgcgcgtgtgttgctggagaacccggatgtcattgtgcaggtg
catgcggattatttccgtgcaggtgcagattgtgcaatcacttccagttatcaggccact
gtcgaaggtttccgcaagcgtggcattggggagcaggccgccctggagctgatccgcaag
acggtagagctggctgcaaaggcgagagatgacgtgtgggcagaagtccgaaataccgca
gatcacgtagatggacctctgcgtcgtccgcgtcctatagtcgctggttccgttgggcca
tacggcgcttatctggcggatggttcagagtatgttgggcattatggcgtatcggatgag
accttggcagcattccatcgtccgcgtatcgcagcgctggttgaagcgggagcagatgtg
ctggcgctggagacgattccttcattgcaggaggcccgggtgctggttgaattgctcaag
gaattccctgaaacaagtgcctggctgtcgttctcgttaaaagacgggacaagcatcagc
gaaggcacaccgcttgaggtatgtgcacaagcctttggctccgagccgcagcttgcggcg
attggtctgaactgcgctccgatggaagtggtgacggaagccatcggcatactgcgtagc
tccagcgacaaaccggttatcgtatatcccaattcaggcgagacttatgatgcggaaacc
aaaacatggagcggccaaggctcctgtggcagtatgaaggatgcatccgagcaatgggtt
gctgcgggcgcacggattattggcggctgctgccgcacaacgccgcatcagattagcgag
ctggcgaggaagtggcgggggtaa

DBGET integrated database retrieval system