Paenibacillus barcinonensis: HUB98_19300 Help Entry HUB98_19300       CDS       T06922                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbac  Paenibacillus barcinonensis Pathway pbac01100   Metabolic pathways pbac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUB98_19300    00074 Mycolic acid biosynthesis     HUB98_19300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUB98_19300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  QKS58179 LinkDB All DBs Position 4245646..4245912 Genome browser AA seq 88 aa AA seqDB search MNETRIKEIITQLIGIEINDIHQNLILVGLDSMKTINLVVELEEEFDIVIDDNDLLFENF STISRIVDLISQKVIGKELYTTKYNELL NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaacaaggattaaagaaatcatcacacagttgatcggtatagaaatcaatgac attcatcaaaatttgattttagttggactagactccatgaaaacaataaatttggtagta gagttggaagaagaattcgatattgtaattgatgataacgacctactattcgagaacttc tctacgatttcaagaatagtagatttgatttctcaaaaagtgataggaaaagaattatac actaccaagtacaacgaactattgtaa

DBGET integrated database retrieval system