Roseinatronobacter sp. S2: P8S53_16485 Help Entry P8S53_16485       CDS       T09279                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pbae  Roseinatronobacter sp. S2 Brite KEGG Orthology (KO) [BR:pbae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbae03036]     P8S53_16485    03400 DNA repair and recombination proteins [BR:pbae03400]     P8S53_16485 Chromosome and associated proteins [BR:pbae03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     P8S53_16485 DNA repair and recombination proteins [BR:pbae03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       P8S53_16485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  WFE74765 LinkDB All DBs Position 3421867..3422148 Genome browser AA seq 93 aa AA seqDB search MTRARWTERTPPPPPEDRQKTEARAKVEAFARELGYSQAELMGGDAKPKRAPIAPKYRHL ENPALTWSGCGRKPQWFVEALEAGKTAEDLTIG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgacgcgtgcacggtggacggaacggacgccgcccccccccccagaggaccgacaaaag acagaagcccgcgccaaggtggaagccttcgccagagagctgggctattcgcaggccgaa ctcatgggcggggatgcaaaacccaagcgcgcgcccatcgcgccgaaataccgccacctt gagaatccggcgctcacctggtccggatgcgggcgcaaaccgcagtggtttgtggaagcg ctggaggcgggcaaaaccgcagaggatttgaccatcggctga

DBGET integrated database retrieval system