Svornostia abyssi: LRS13_04185 Help Entry LRS13_04185       CDS       T09859                                  Name (GenBank) flagellar basal body protein   KO K02388   flagellar basal-body rod protein FlgC Organism pbaj  Svornostia abyssi Pathway pbaj02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pbaj00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     LRS13_04185  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pbaj02035]     LRS13_04185 Bacterial motility proteins [BR:pbaj02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     LRS13_04185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flg_bb_rod Motif Other DBs NCBI-ProteinID:  UUY04737 LinkDB All DBs Position 856106..856411 Genome browser AA seq 101 aa AA seqDB search MGLFDALNVSATGLSAERTRMDVIANNLANAQTTRGPDGQPFRRQEVLLQSESSTFASVL SSEVGAKARTNGPPKGVRVVEVAEDPTPEPPRLRPGPPGRR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgggtctcttcgacgcactcaacgtctccgcgaccggcctgtcggccgagcgcacgcgg atggacgtcatcgccaacaatctcgcgaacgcgcagaccacgcgcggcccggacggccag ccgttccgccgccaggaggtcctgctgcagtccgagtcctcgaccttcgccagcgtgctc agcagcgaggtcggcgcgaaggcccgcacgaacggcccgccgaagggcgtccgcgtcgtg gaggtcgccgaggatccgacccccgaaccgccgcgtctacgacccgggccacccggacgc cgatga

DBGET integrated database retrieval system