Pseudomonas batumici: NUH87_25310 Help Entry NUH87_25310       CDS       T10437                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbam  Pseudomonas batumici Pathway pbam01100   Metabolic pathways pbam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NUH87_25310    00074 Mycolic acid biosynthesis     NUH87_25310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NUH87_25310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding mTERF DUF1493 YjiS-like Motif Other DBs NCBI-ProteinID:  WVV61482 LinkDB All DBs Position 5538237..5538530 Genome browser AA seq 97 aa AA seqDB search MSYLDPGGCDYFIEQQVMVLLAEHFSVSRRKIRFESRMLEDLGIDEADLAELVGRFNAAF GIELSVAEAVRWRTVADMCRCVGNARGARGERRNLLL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagttacctggatccgggagggtgtgactattttatcgagcagcaggtgatggtgttg ctggccgagcatttttcagtgtcgcgcagaaagatccgcttcgagtcgagaatgctggaa gacctgggtatcgacgaggcggatcttgccgagctggtggggcggttcaatgcggcgttc ggtatcgagctgtcggtcgctgaggctgttcgctggcgtaccgtggcggatatgtgccgc tgtgtaggaaacgcccgtggagcgcgcggggagcggcgaaatctcctgctttga

DBGET integrated database retrieval system