Pasteurellaceae bacterium NI1060: AC062_0787
Help
Entry
AC062_0787 CDS
T10491
Name
(GenBank) LSU ribosomal protein L18p (L5e)
KO
K02881
large subunit ribosomal protein L18
Organism
pban Pasteurellaceae bacterium NI1060
Pathway
pban03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pban00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AC062_0787
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pban03011
]
AC062_0787
Ribosome [BR:
pban03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AC062_0787
Bacteria
AC062_0787
Archaea
AC062_0787
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Pyr_redox_dim
Ribosomal_L5e
TM1506
Motif
Other DBs
NCBI-ProteinID:
AOF52882
LinkDB
All DBs
Position
complement(847349..847702)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKSARIRRAARARYMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAVVGKTVAERALAKGVKAVAFDRSGFKYHGRVQTLADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaatcagctcgtatccgtcgtgcagctcgtgcacgctatatgatgagagag
caaggtgtaactcgtttagttattcaccgtactccacgtcatatttatgcacaagttatt
gcaccaaacggttcagaagtgcttgccgctgcttcaactgttgagaaagcaattcgtgag
caagtaaaatatactggtaacaaagatgctgctgctgtagtaggtaaaactgttgcagag
cgtgccttggcaaaaggcgtaaaggcagttgcttttgatcgttccggttttaaatatcat
ggacgtgtccaaactttagcggacgctgctcgtgaagctggtctacagttctaa
DBGET
integrated database retrieval system