Limihaloglobus sulfuriphilus: SMSP2_00493 Help Entry SMSP2_00493       CDS       T04749                                  Name (GenBank) RNA polymerase Rpb6   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism pbas  Limihaloglobus sulfuriphilus Pathway pbas03020   RNA polymerase Brite KEGG Orthology (KO) [BR:pbas00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SMSP2_00493  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pbas03021]     SMSP2_00493    03400 DNA repair and recombination proteins [BR:pbas03400]     SMSP2_00493 Enzymes [BR:pbas01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      SMSP2_00493 Transcription machinery [BR:pbas03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      SMSP2_00493 DNA repair and recombination proteins [BR:pbas03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       SMSP2_00493 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  AQQ70151 UniProt:  A0A1Q2MBU2 LinkDB All DBs Position complement(632067..632303) Genome browser AA seq 78 aa AA seqDB search MIEALKHQDIVDKVGGKFKLSALIQKRMKEILEGSRPLIDDTKGKTLMEIVVQEILEDKI TLEQAAPKETTIDPFAAF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatagaagcattaaaacatcaggacatagtcgataaggtcggcggcaaattcaaactc tccgcccttatccagaaacgtatgaaagaaatcctcgaaggctcccgccctcttatcgat gatacaaagggaaagactttgatggaaatcgttgtgcaggagatacttgaggataaaatc actctcgagcaggcagcaccaaaagaaacgaccattgatcctttcgcggcgttttga

DBGET integrated database retrieval system