Pseudomonadaceae bacterium T75: OS670_21455 Help Entry OS670_21455       CDS       T08742                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pbau  Pseudomonadaceae bacterium T75 Brite KEGG Orthology (KO) [BR:pbau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pbau03032]     OS670_21455    03036 Chromosome and associated proteins [BR:pbau03036]     OS670_21455    03400 DNA repair and recombination proteins [BR:pbau03400]     OS670_21455 DNA replication proteins [BR:pbau03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OS670_21455 Chromosome and associated proteins [BR:pbau03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OS670_21455 DNA repair and recombination proteins [BR:pbau03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OS670_21455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WAD28860 LinkDB All DBs Position pT75-VIM:complement(179709..179993) Genome browser AA seq 94 aa AA seqDB search MTRQELVKAVAERAGHSQTAVNEMLNAMIGTIQDTVAAGDKVVLVGFGAFEPVSRPERDG RNPQTGAKITIAASTTPKFTPGKAFKDAVNQGGK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgactcgacaggaactggtaaaggccgttgcagagcgggcaggccacagccaaaccgct gtaaacgaaatgctcaacgccatgattgggacgatccaggacaccgtggctgcaggggac aaagtggtactggtcggcttcggcgctttcgagccggtgagccggcctgagcgcgatggg cgcaatcctcagaccggcgcgaagatcaccattgccgcatcgacgaccccgaagttcacc cccggcaaggcattcaaggatgccgtcaatcaggggggaaaatga

DBGET integrated database retrieval system