Thiopseudomonas alkaliphila: AKN87_06705 Help Entry AKN87_06705       CDS       T04152                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pbb  Thiopseudomonas alkaliphila Brite KEGG Orthology (KO) [BR:pbb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbb03036]     AKN87_06705 Chromosome and associated proteins [BR:pbb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AKN87_06705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Dynactin_p22 NCH2 DUF4795 XRCC4_CC bZIP_1 TSC22 DUF3450 BBS2_hp SKA2 Nif11 DUF7799 MGT5A_N YabA RuvC eIF3h_C bZIP_2 Motif Other DBs NCBI-ProteinID:  AKX44824 UniProt:  A0A0K1XD38 LinkDB All DBs Position complement(1382693..1382887) Genome browser AA seq 64 aa AA seqDB search MSQDNLQKLLERVDQLVTQHLDLQARYQQLSEENQQLLQQHTQACATIERILVRLDALEQ SDDF NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgagccaagataacttacagaagctactagagcgggttgatcaattagtgacccagcac ttagatttgcaagcgcgctatcagcagttgagtgaggaaaatcaacagttacttcaacaa cacactcaagcatgtgcaaccatcgagcggatattagtacgcttagatgcactggagcag agcgatgacttctaa

DBGET integrated database retrieval system