Pseudomonas brassicacearum DF41: CD58_01710 Help Entry CD58_01710        CDS       T03174                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism pbc  Pseudomonas brassicacearum DF41 Brite KEGG Orthology (KO) [BR:pbc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pbc03110]     CD58_01710 Chaperones and folding catalysts [BR:pbc03110]  Protein folding catalysts   Protein disulfide isomerase    CD58_01710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 CLIC-like_N GST_N SH3BGR Motif Other DBs NCBI-ProteinID:  AHL31687 UniProt:  A0AAQ0Q2K6 LinkDB All DBs Position 375310..375564 Genome browser AA seq 84 aa AA seqDB search MAHVVVYSSDYCPYCSRAKFLLQNKGVAFEEIKVDGKPQLRAEMTQKAGRTSVPQIWIGS THVGGCDDLFALERAGKLDALLKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcccacgtcgttgtctattccagcgattactgcccctattgctccagagccaagttc ctgctccagaacaaaggtgtggctttcgaagagatcaaggtcgacggcaagccgcaactg cgcgccgaaatgacccaaaaggccggacgtacctccgtgccgcagatctggatcggcagc acccacgtaggcggctgcgatgatctgttcgccctggagcgcgccggcaagctcgacgcg ctgctcaaggcctga

DBGET integrated database retrieval system