Pseudomonas brassicacearum DF41: CD58_02320 Help Entry CD58_02320        CDS       T03174                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbc  Pseudomonas brassicacearum DF41 Pathway pbc01100   Metabolic pathways pbc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CD58_02320    00074 Mycolic acid biosynthesis     CD58_02320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CD58_02320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHL31801 LinkDB All DBs Position complement(514030..514290) Genome browser AA seq 86 aa AA seqDB search MSDLHRDIKKLIIDALGLEDISIDDIGDHQTLFGEGLGLDSVDALELGLAIQKEYGIKID ADAKDTRNHFSNVASLAAFVTAKSVA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgacatcaaaaagctgatcatcgacgccctgggccttgaggac atcagcatcgacgacatcggcgaccaccagaccctgttcggcgaaggcctgggcctggac tcggtggatgccctggaacttggcctggcgatccagaaggagtacggcatcaagatcgat gccgacgccaaggacacccgtaaccacttcagcaatgtggcaagccttgcggccttcgtc actgcaaaaagcgtagcctga

DBGET integrated database retrieval system