Pseudomonas brassicacearum DF41: CD58_28380 Help Entry CD58_28380        CDS       T03174                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pbc  Pseudomonas brassicacearum DF41 Brite KEGG Orthology (KO) [BR:pbc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbc03036]     CD58_28380 Chromosome and associated proteins [BR:pbc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CD58_28380 SSDB OrthologParalogGFIT Motif Pfam:  Filament Asd-4 ZapB_rel ZapB TscT VGPC1_C TPR_MLP1_2 ZNF318_helical Macoilin Motif Other DBs NCBI-ProteinID:  AHL36552 UniProt:  A0AAW8MG12 LinkDB All DBs Position 6334127..6334336 Genome browser AA seq 69 aa AA seqDB search MEDNDLQALMARLELLIDRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaacgacctgcaagcgctgatggccagactcgaattgctaattgaccgggtc gagcaacttaagagccaaaacggactcctattagctcaggaaaaaacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system