Paenibacillus borealis: PBOR_00245 Help Entry PBOR_00245        CDS       T03324                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pbd  Paenibacillus borealis Brite KEGG Orthology (KO) [BR:pbd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pbd03032]     PBOR_00245    03036 Chromosome and associated proteins [BR:pbd03036]     PBOR_00245    03400 DNA repair and recombination proteins [BR:pbd03400]     PBOR_00245 DNA replication proteins [BR:pbd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PBOR_00245 Chromosome and associated proteins [BR:pbd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PBOR_00245 DNA repair and recombination proteins [BR:pbd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PBOR_00245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AIQ55581 UniProt:  A0A089L278 LinkDB All DBs Position 50978..51250 Genome browser AA seq 90 aa AA seqDB search MNKTDLVNNISEKSGLAKKDVEAVLNGVLGEITEALASGDKVQLIGFGTFETRKRSGRTG RNPQSGTPIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctggtaaacaacatttccgaaaaaagcggattggccaaaaaagat gtagaagcagtactcaacggggttctgggcgaaattacagaagctctggcaagcggagat aaagtgcagctgatcggattcggtactttcgaaacccgcaaacgttccggccgtaccggc cgtaacccgcaatcgggcacacctattgaaatccccgaatcgactgtaccggccttcaag gcaggtaacaagcttaaagaagccgtcaactaa

DBGET integrated database retrieval system