Paenibacillus borealis: PBOR_08450 Help Entry PBOR_08450        CDS       T03324                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pbd  Paenibacillus borealis Pathway pbd00998   Biosynthesis of various antibiotics pbd01100   Metabolic pathways pbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PBOR_08450    00074 Mycolic acid biosynthesis     PBOR_08450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PBOR_08450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIQ56956 UniProt:  A0A089L677 LinkDB All DBs Position 1914674..1914949 Genome browser AA seq 91 aa AA seqDB search MRKEVDQKIRTILSEMTNQDLDLLGEDFVLTRDLGFDSIRFIALIVNIENVFLINFDDKY LSIDKIDQYSLLLAYVCLMVSELKTNDSQSS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagaaaagaagttgatcaaaaaattagaacgatccttagtgaaatgacgaatcaagat ttagatttactgggggaagactttgtcttaacacgggatttaggttttgattcaatacgt tttattgcgctcatagtgaatatagaaaatgtgtttttaattaatttcgatgacaaatac ctttccattgataaaatcgatcagtattctttattactggcctatgtatgtctaatggtc tcggagttgaaaacaaatgattctcaatcgtcttga

DBGET integrated database retrieval system