Paenibacillus borealis: PBOR_19370 Help Entry PBOR_19370        CDS       T03324                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pbd  Paenibacillus borealis Pathway pbd00998   Biosynthesis of various antibiotics pbd01100   Metabolic pathways pbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PBOR_19370    00074 Mycolic acid biosynthesis     PBOR_19370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PBOR_19370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF4167 Motif Other DBs NCBI-ProteinID:  AIQ58846 UniProt:  A0A089LBH7 LinkDB All DBs Position complement(4428902..4429171) Genome browser AA seq 89 aa AA seqDB search MEERISFAQFQGIFSEYLGIEASRLTPEVNLLLELGVDSLSLVNVMLRLEREYQVMFNPE DRVMTRTLGEAYELFDKYRSLGEEAQTSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaagaacggataagctttgcgcagttccagggcatcttttcggaatatttgggaatt gaagcttcccggctgaccccggaggtcaatctgctgctggagctgggggtcgattcctta tctttggtcaacgtgatgctaaggctggaaagagagtaccaggtcatgttcaatcccgaa gaccgggtaatgacccggacactgggcgaagcctatgagctgtttgacaaatatagaagt ttgggcgaggaagcgcagaccagcggttaa

DBGET integrated database retrieval system