Paenibacillus borealis: PBOR_34075
Help
Entry
PBOR_34075 CDS
T03324
Name
(GenBank) RNA helicase
KO
K05592
ATP-dependent RNA helicase DeaD [EC:
5.6.2.7
]
Organism
pbd
Paenibacillus borealis
Pathway
pbd03018
RNA degradation
Brite
KEGG Orthology (KO) [BR:
pbd00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03018 RNA degradation
PBOR_34075
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:
pbd03019
]
PBOR_34075
03009 Ribosome biogenesis [BR:
pbd03009
]
PBOR_34075
Enzymes [BR:
pbd01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.7 DEAD-box RNA helicase
PBOR_34075
Messenger RNA biogenesis [BR:
pbd03019
]
Prokaryotic type
Bacterial mRNA degradation factors
RNA degradosome components
Helicases
PBOR_34075
Ribosome biogenesis [BR:
pbd03009
]
Prokaryotic type
rRNA helicases
PBOR_34075
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DEAD
Helicase_C
ResIII
Cas3-like_C_2
AAA_19
AAA_22
Motif
Other DBs
NCBI-ProteinID:
AIQ61375
UniProt:
A0A089LMR7
LinkDB
All DBs
Position
complement(7698219..7700132)
Genome browser
AA seq
637 aa
AA seq
DB search
MPGFKELGVSEVLVDLLKGQGIVKPTPVQEEAIPPLVQGLDVIARAKTGTGKTLAFLLPI
MDKIRVEAAYPQALILAPTRELALQITEEARKLARHTGVKILAVYGGQDVEKQLRKLEGG
RHLIIGTPGRLLDHLRRETLDLNGVKMLVLDEADQMLHMGFLEDVETIITAVPYRRQTML
FSATMPDPIKRLAANYMKEPLDIIIKSGSPIPLDNIRQQVVECSDRNKEEALISLIERDR
PYLAIIFCRTKRRAIKLNEALQAAGYDCDELHGDLSQGKREAVMKRFRDAKLQLLVATDV
AARGLDVEGITHIFNYDLPLDADSYIHRIGRTGRAGGKGLAITFSSPRERAGLELIEHGI
SQRLDRRRYEKDEFGVGEFTSVQGGGSPRGGRQSAAPEAARAGRGGRGQGRSGGAPRAEA
AGRPGGRGGKDAGGWGAPAEGGSRSRKDAAGGGGGKRSAYSAAAAPRGGDSAGKSAAKPR
PGGGYGAFASGGDSSPAPGYAAGANAAGGRGGNKGGGARSGGPSSGYSTNVSRGADTGGF
SYGASKGAGSGAGYNPGGAKSSPKFRAHVARSNEGGGSGAPASKGGGSRGGYSAGGGSKG
GKGGFGSGGRSSGGTSSRGGRSGGSGGGSRGGRGSSR
NT seq
1914 nt
NT seq
+upstream
nt +downstream
nt
ttgccgggttttaaggaattaggagtttctgaagtactagtcgatctgctcaaggggcag
gggattgtgaagccgacgccggttcaggaggaagcgattccgccgctggtgcagggcctc
gatgtgattgcccgtgccaagacaggaacagggaagacactggctttcctgctgccgata
atggacaagatccgggtagaggcggcttatccgcaggcgctgattctcgcgccgacgcgt
gaactcgcgctgcagattaccgaggaagcgcgtaagctggcgcgtcatacgggagttaag
attctggcagtctacggcggccaggatgtggagaaacagctccgcaagctggaaggcggc
agacatctgattatcggaacaccgggacggctgctggatcacctgcgccgggagacgctg
gatctgaacggcgtgaagatgctggtgctggatgaagcggaccagatgctgcacatgggc
ttcctggaggatgtagagacgattattacggctgtgccttaccggcgccagacgatgctg
ttctctgcgacaatgccggacccgatcaaacggctggctgcgaattatatgaaagaaccg
cttgatatcattatcaagagcggctccccgattccgctggacaatatccgccagcaggtt
gtggaatgctccgaccgcaataaggaagaagcgctgatctccctgattgagcgggaccgc
ccttatctggcgatcatcttctgccggaccaagcgccgggccatcaagctgaacgaagcg
ttgcaggcggccgggtatgactgcgatgaattgcacggcgacttgtcgcagggcaaacgc
gaagcggtcatgaagcggttccgcgatgccaagctccagctgctggtggctacggatgtg
gccgcgcgcgggcttgatgtggagggcatcacccacatcttcaactacgatcttccgctg
gatgcggacagctatattcaccggatcggccgcacgggccgcgccggaggcaaaggcctg
gcgatcacgttctcttcgccgcgtgaacgcgccgggctcgaactgatcgagcacggcatt
tcccagcggctggaccgccgccggtacgagaaggatgaattcggcgttggcgaattcacc
tctgtgcaaggcggcggctcgccgcgcggcgggcggcagagcgcagcgcctgaagcggcg
cgcgctggacgcggcggccgcgggcagggccgcagcggcggtgctccgcgcgcggaagcc
gcagggcgtccgggcggacgcggcggcaaggacgcaggcggctggggtgcgcctgcggaa
ggcggaagccgcagccgtaaggacgcggcaggcggcggtggcggcaagcgcagcgcgtac
agcgcagctgcggctccgcgcggcggcgactccgccggcaagagcgcggcgaagccaaga
ccgggcggcggctacggcgcctttgccagcggcggcgacagcagcccggctccgggttat
gcggctggagcgaatgccgcaggcggacgcggcggcaataagggcggcggcgccagaagc
ggcggcccgagcagcggctacagcaccaatgtatccagaggcgcggataccggcggattc
agctacggtgcttcgaagggcgccggctccggtgccgggtacaatcccggcggcgcgaag
tcgagcccgaaattccgggcgcatgtagcccgcagcaatgaaggcggcggctcaggcgct
ccagcttccaaaggcggcggctcgcgcggcggttacagcgcgggcggcggctccaagggc
ggcaaaggcggatttggctcgggtggacgcagcagcggcggaacctcatcgcgcggggga
cgcagtggcggctcaggcggcggttcacgcggcggacgcggctcatccagataa
DBGET
integrated database retrieval system