Podospora bellae-mahoneyi: QC761_111950 Help Entry QC761_111950      CDS       T09795                                  Name (RefSeq) uncharacterized protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism pbel  Podospora bellae-mahoneyi Pathway pbel03018   RNA degradation pbel03040   Spliceosome Brite KEGG Orthology (KO) [BR:pbel00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     QC761_111950   09123 Folding, sorting and degradation    03018 RNA degradation     QC761_111950  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pbel03019]     QC761_111950    03041 Spliceosome [BR:pbel03041]     QC761_111950 Messenger RNA biogenesis [BR:pbel03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      QC761_111950   mRNA degradation factors    5'-3' decay     Lsm complex      QC761_111950 Spliceosome [BR:pbel03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     QC761_111950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  87893960 NCBI-ProteinID:  XP_062737609 LinkDB All DBs Position 1 Genome browser AA seq 97 aa AA seqDB search MSINSYISKKVCIITTDGRTLVGTLAAYDNTTNLVLQNTIERIIRTPDDAEPSAQVPLGL YLIRGENVCTIGLVDEALDDSINWAEVKGAVIGTTKH NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcaatcaacagctacatctccaaaaaggtctgcatcatcaccaccgacggcagaacg ctggtcggcaccctcgccgcgtacgacaacacaaccaacctcgtcctccaaaacaccatc gagcgtatcatccgcacccccgatgacgccgagccctcggcccaggttcccctgggcctc tacctcatccgcggcgagaacgtctgcacgatcgggctcgtggacgaggcgctagacgac agcatcaactgggccgaggtcaaaggggctgtgattgggactacgaagcattaa

DBGET integrated database retrieval system