Podospora bellae-mahoneyi: QC761_119070 Help Entry QC761_119070      CDS       T09795                                  Symbol RAC1 Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pbel  Podospora bellae-mahoneyi Pathway pbel04145   Phagosome pbel04148   Efferocytosis pbel04517   IgSF CAM signaling pbel04518   Integrin signaling pbel04620   Toll-like receptor signaling pathway pbel05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pbel00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     QC761_119070 (RAC1)    04518 Integrin signaling     QC761_119070 (RAC1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     QC761_119070 (RAC1)    04148 Efferocytosis     QC761_119070 (RAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     QC761_119070 (RAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     QC761_119070 (RAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbel04131]     QC761_119070 (RAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbel04147]     QC761_119070 (RAC1)    04031 GTP-binding proteins [BR:pbel04031]     QC761_119070 (RAC1) Membrane trafficking [BR:pbel04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     QC761_119070 (RAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     QC761_119070 (RAC1)   Macropinocytosis    Ras GTPases     QC761_119070 (RAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     QC761_119070 (RAC1) Exosome [BR:pbel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    QC761_119070 (RAC1)   Exosomal proteins of other body fluids (saliva and urine)    QC761_119070 (RAC1)   Exosomal proteins of colorectal cancer cells    QC761_119070 (RAC1)   Exosomal proteins of bladder cancer cells    QC761_119070 (RAC1) GTP-binding proteins [BR:pbel04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     QC761_119070 (RAC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  87894673 NCBI-ProteinID:  XP_062738431 LinkDB All DBs Position 1 Genome browser AA seq 200 aa AA seqDB search MATPPVQSIKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVTVDGRPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPPSFDNVKAKWWPEIGHHAPNIPIVLVGT KLDARDDPNTLKTMAEKRWSPITYPMGLALAKEIGAYKYAECSALTQMGLKTVFDYAIRA VIEPKAAPQTKKKSSKCTLL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggccaccccgcccgtccagtcgatcaagtgcgtcgtcacaggtgatggtgccgtcggc aagacatgtctgctcatctcctacacaacaaatgctttccccggcgaatacatccccacg gtattcgacaactactctgcgagcgtaactgttgatggaaggcccatcagcttggggttg tgggatacggccggtcaggaagattacgacagactgcggcctctctcatacccccagacc gatgttttcctcatctgcttctccctcgtcagccctccttcgtttgacaacgtgaaggcc aagtggtggcctgaaatcggacatcacgctcccaatattcccattgtgctggttggcacc aagctggacgccagagatgaccctaatacgctcaagacaatggccgagaagcggtggtcg cctattacctaccccatgggattggcccttgccaaggagattggagcttacaagtacgcc gaatgctctgccttgacacagatgggtctcaagaccgtctttgactatgccatcagagcc gtcattgagcccaaggccgctcctcagacgaagaagaagtcgtccaagtgcacgctcctc taa

DBGET integrated database retrieval system