Podospora bellae-mahoneyi: QC761_210810 Help Entry QC761_210810      CDS       T09795                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pbel  Podospora bellae-mahoneyi Pathway pbel03060   Protein export pbel04141   Protein processing in endoplasmic reticulum pbel04145   Phagosome Brite KEGG Orthology (KO) [BR:pbel00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     QC761_210810    04141 Protein processing in endoplasmic reticulum     QC761_210810  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     QC761_210810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbel04131]     QC761_210810   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pbel02044]     QC761_210810 Membrane trafficking [BR:pbel04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     QC761_210810 Secretion system [BR:pbel02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    QC761_210810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  87896298 NCBI-ProteinID:  XP_062735450 LinkDB All DBs Position 2:3930969..3933378 Genome browser AA seq 70 aa AA seqDB search MSDQVQEILDVPREFLKDGIQFIHKAQKPDQKEFLKISQAVGVGFLIMGAVGYFVKLIHV PLNNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccaagtgcaagaaatcctcgacgtccctcgcgagttcctcaaggacggcatc cagttcatccacaaagctcagaagcccgaccagaaggagtttctcaagatctcgcaagcc gttggcgtcggtttcctcatcatgggcgccgtcggctacttcgtcaagctcatccacgtt ccccttaacaacatcctcgtcggtggcgcgtaa

DBGET integrated database retrieval system