Podospora bellae-mahoneyi: QC761_307060 Help Entry QC761_307060      CDS       T09795                                  Symbol RHO1 Name (RefSeq) GTP-binding protein Rho1   KO K04513   Ras homolog gene family, member A Organism pbel  Podospora bellae-mahoneyi Pathway pbel04011   MAPK signaling pathway - yeast pbel04081   Hormone signaling pbel04144   Endocytosis pbel05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pbel00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     QC761_307060 (RHO1)   09133 Signaling molecules and interaction    04081 Hormone signaling     QC761_307060 (RHO1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     QC761_307060 (RHO1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     QC761_307060 (RHO1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbel04131]     QC761_307060 (RHO1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbel04147]     QC761_307060 (RHO1)    04031 GTP-binding proteins [BR:pbel04031]     QC761_307060 (RHO1) Membrane trafficking [BR:pbel04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     QC761_307060 (RHO1) Exosome [BR:pbel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    QC761_307060 (RHO1)   Exosomal proteins of other body fluids (saliva and urine)    QC761_307060 (RHO1)   Exosomal proteins of colorectal cancer cells    QC761_307060 (RHO1)   Exosomal proteins of bladder cancer cells    QC761_307060 (RHO1) GTP-binding proteins [BR:pbel04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     QC761_307060 (RHO1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  87897327 NCBI-ProteinID:  XP_062733660 LinkDB All DBs Position 3:2404101..2406670 Genome browser AA seq 194 aa AA seqDB search MAAELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWD TAGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVGEKWCSEVHHFCPDVPKILVGCKK DLRFDQKTIEELRKTSQQPVSPEQGQQVATNIKATKYLECSAKTNEGVREVFEFATRAAL MKKSSKKKGKCVIA NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggccgccgagcttcgccggaagttggttatcgtcggtgacggtgcctgcggaaagacg tgcttgttgattgttttctccaagggtaccttcccagaggtctatgtccctaccgtcttc gaaaactacgttgccgatgtcgaggttgatggaaagcacgtcgagctcgccctttgggat acggctggccaagaggattacgaccgtctccgccctctctcttaccccgactcccacgtc atcttgatctgcttcgccatcgactcgcccgattccctcgacaacgttggcgagaagtgg tgctccgaggtacaccatttctgtcccgatgttcccaagatccttgttggttgcaagaag gatctccgtttcgaccagaagaccatcgaggagctccgcaagaccagccagcagcccgtg tctcctgaacagggtcaacaagttgccaccaacatcaaggccaccaagtatctcgagtgc tccgccaagaccaacgagggtgtccgggaagtgttcgagttcgcgacgcgggccgcgttg atgaagaagtcatcaaagaagaagggcaagtgcgtcatcgcctaa

DBGET integrated database retrieval system