Prionailurus bengalensis (leopard cat): 122470222 Help Entry 122470222         CDS       T07574                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg02010   ABC transporters pbg05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     122470222 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     122470222 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pbg02000]     122470222 (DEFB1)    03037 Cilium and associated proteins [BR:pbg03037]     122470222 (DEFB1) Transporters [BR:pbg02000]  Other transporters   Pores ion channels [TC:1]    122470222 (DEFB1) Cilium and associated proteins [BR:pbg03037]  Motile cilia and associated proteins   Sperm associated proteins    122470222 (DEFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  122470222 NCBI-ProteinID:  XP_043413532 LinkDB All DBs Position B1:complement(6712701..6725256) Genome browser AA seq 68 aa AA seqDB search MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga ggaacctgtaacttttctccatgcccactttttaccaggatcgatggcacctgctatggt ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system