KEGG   Prionailurus bengalensis (leopard cat): 122470517
Entry
122470517         CDS       T07574                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pbg  Prionailurus bengalensis (leopard cat)
Pathway
pbg01521  EGFR tyrosine kinase inhibitor resistance
pbg01522  Endocrine resistance
pbg01524  Platinum drug resistance
pbg04010  MAPK signaling pathway
pbg04012  ErbB signaling pathway
pbg04014  Ras signaling pathway
pbg04015  Rap1 signaling pathway
pbg04022  cGMP-PKG signaling pathway
pbg04024  cAMP signaling pathway
pbg04062  Chemokine signaling pathway
pbg04066  HIF-1 signaling pathway
pbg04068  FoxO signaling pathway
pbg04071  Sphingolipid signaling pathway
pbg04072  Phospholipase D signaling pathway
pbg04114  Oocyte meiosis
pbg04140  Autophagy - animal
pbg04148  Efferocytosis
pbg04150  mTOR signaling pathway
pbg04151  PI3K-Akt signaling pathway
pbg04210  Apoptosis
pbg04218  Cellular senescence
pbg04261  Adrenergic signaling in cardiomyocytes
pbg04270  Vascular smooth muscle contraction
pbg04350  TGF-beta signaling pathway
pbg04360  Axon guidance
pbg04370  VEGF signaling pathway
pbg04371  Apelin signaling pathway
pbg04380  Osteoclast differentiation
pbg04510  Focal adhesion
pbg04520  Adherens junction
pbg04540  Gap junction
pbg04550  Signaling pathways regulating pluripotency of stem cells
pbg04611  Platelet activation
pbg04613  Neutrophil extracellular trap formation
pbg04620  Toll-like receptor signaling pathway
pbg04621  NOD-like receptor signaling pathway
pbg04625  C-type lectin receptor signaling pathway
pbg04650  Natural killer cell mediated cytotoxicity
pbg04657  IL-17 signaling pathway
pbg04658  Th1 and Th2 cell differentiation
pbg04659  Th17 cell differentiation
pbg04660  T cell receptor signaling pathway
pbg04662  B cell receptor signaling pathway
pbg04664  Fc epsilon RI signaling pathway
pbg04666  Fc gamma R-mediated phagocytosis
pbg04668  TNF signaling pathway
pbg04713  Circadian entrainment
pbg04720  Long-term potentiation
pbg04722  Neurotrophin signaling pathway
pbg04723  Retrograde endocannabinoid signaling
pbg04724  Glutamatergic synapse
pbg04725  Cholinergic synapse
pbg04726  Serotonergic synapse
pbg04730  Long-term depression
pbg04810  Regulation of actin cytoskeleton
pbg04910  Insulin signaling pathway
pbg04912  GnRH signaling pathway
pbg04914  Progesterone-mediated oocyte maturation
pbg04915  Estrogen signaling pathway
pbg04916  Melanogenesis
pbg04917  Prolactin signaling pathway
pbg04919  Thyroid hormone signaling pathway
pbg04921  Oxytocin signaling pathway
pbg04926  Relaxin signaling pathway
pbg04928  Parathyroid hormone synthesis, secretion and action
pbg04929  GnRH secretion
pbg04930  Type II diabetes mellitus
pbg04933  AGE-RAGE signaling pathway in diabetic complications
pbg04934  Cushing syndrome
pbg04935  Growth hormone synthesis, secretion and action
pbg04960  Aldosterone-regulated sodium reabsorption
pbg05010  Alzheimer disease
pbg05020  Prion disease
pbg05022  Pathways of neurodegeneration - multiple diseases
pbg05034  Alcoholism
pbg05132  Salmonella infection
pbg05133  Pertussis
pbg05135  Yersinia infection
pbg05140  Leishmaniasis
pbg05142  Chagas disease
pbg05145  Toxoplasmosis
pbg05152  Tuberculosis
pbg05160  Hepatitis C
pbg05161  Hepatitis B
pbg05163  Human cytomegalovirus infection
pbg05164  Influenza A
pbg05165  Human papillomavirus infection
pbg05166  Human T-cell leukemia virus 1 infection
pbg05167  Kaposi sarcoma-associated herpesvirus infection
pbg05170  Human immunodeficiency virus 1 infection
pbg05171  Coronavirus disease - COVID-19
pbg05200  Pathways in cancer
pbg05203  Viral carcinogenesis
pbg05205  Proteoglycans in cancer
pbg05206  MicroRNAs in cancer
pbg05207  Chemical carcinogenesis - receptor activation
pbg05208  Chemical carcinogenesis - reactive oxygen species
pbg05210  Colorectal cancer
pbg05211  Renal cell carcinoma
pbg05212  Pancreatic cancer
pbg05213  Endometrial cancer
pbg05214  Glioma
pbg05215  Prostate cancer
pbg05216  Thyroid cancer
pbg05218  Melanoma
pbg05219  Bladder cancer
pbg05220  Chronic myeloid leukemia
pbg05221  Acute myeloid leukemia
pbg05223  Non-small cell lung cancer
pbg05224  Breast cancer
pbg05225  Hepatocellular carcinoma
pbg05226  Gastric cancer
pbg05230  Central carbon metabolism in cancer
pbg05231  Choline metabolism in cancer
pbg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pbg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pbg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122470517 (MAPK1)
   04012 ErbB signaling pathway
    122470517 (MAPK1)
   04014 Ras signaling pathway
    122470517 (MAPK1)
   04015 Rap1 signaling pathway
    122470517 (MAPK1)
   04350 TGF-beta signaling pathway
    122470517 (MAPK1)
   04370 VEGF signaling pathway
    122470517 (MAPK1)
   04371 Apelin signaling pathway
    122470517 (MAPK1)
   04668 TNF signaling pathway
    122470517 (MAPK1)
   04066 HIF-1 signaling pathway
    122470517 (MAPK1)
   04068 FoxO signaling pathway
    122470517 (MAPK1)
   04072 Phospholipase D signaling pathway
    122470517 (MAPK1)
   04071 Sphingolipid signaling pathway
    122470517 (MAPK1)
   04024 cAMP signaling pathway
    122470517 (MAPK1)
   04022 cGMP-PKG signaling pathway
    122470517 (MAPK1)
   04151 PI3K-Akt signaling pathway
    122470517 (MAPK1)
   04150 mTOR signaling pathway
    122470517 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122470517 (MAPK1)
   04148 Efferocytosis
    122470517 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    122470517 (MAPK1)
   04210 Apoptosis
    122470517 (MAPK1)
   04218 Cellular senescence
    122470517 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122470517 (MAPK1)
   04520 Adherens junction
    122470517 (MAPK1)
   04540 Gap junction
    122470517 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    122470517 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122470517 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122470517 (MAPK1)
   04613 Neutrophil extracellular trap formation
    122470517 (MAPK1)
   04620 Toll-like receptor signaling pathway
    122470517 (MAPK1)
   04621 NOD-like receptor signaling pathway
    122470517 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    122470517 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    122470517 (MAPK1)
   04660 T cell receptor signaling pathway
    122470517 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    122470517 (MAPK1)
   04659 Th17 cell differentiation
    122470517 (MAPK1)
   04657 IL-17 signaling pathway
    122470517 (MAPK1)
   04662 B cell receptor signaling pathway
    122470517 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    122470517 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    122470517 (MAPK1)
   04062 Chemokine signaling pathway
    122470517 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122470517 (MAPK1)
   04929 GnRH secretion
    122470517 (MAPK1)
   04912 GnRH signaling pathway
    122470517 (MAPK1)
   04915 Estrogen signaling pathway
    122470517 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    122470517 (MAPK1)
   04917 Prolactin signaling pathway
    122470517 (MAPK1)
   04921 Oxytocin signaling pathway
    122470517 (MAPK1)
   04926 Relaxin signaling pathway
    122470517 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    122470517 (MAPK1)
   04919 Thyroid hormone signaling pathway
    122470517 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    122470517 (MAPK1)
   04916 Melanogenesis
    122470517 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122470517 (MAPK1)
   04270 Vascular smooth muscle contraction
    122470517 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122470517 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    122470517 (MAPK1)
   04725 Cholinergic synapse
    122470517 (MAPK1)
   04726 Serotonergic synapse
    122470517 (MAPK1)
   04720 Long-term potentiation
    122470517 (MAPK1)
   04730 Long-term depression
    122470517 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    122470517 (MAPK1)
   04722 Neurotrophin signaling pathway
    122470517 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    122470517 (MAPK1)
   04380 Osteoclast differentiation
    122470517 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    122470517 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122470517 (MAPK1)
   05206 MicroRNAs in cancer
    122470517 (MAPK1)
   05205 Proteoglycans in cancer
    122470517 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    122470517 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    122470517 (MAPK1)
   05203 Viral carcinogenesis
    122470517 (MAPK1)
   05230 Central carbon metabolism in cancer
    122470517 (MAPK1)
   05231 Choline metabolism in cancer
    122470517 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122470517 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122470517 (MAPK1)
   05212 Pancreatic cancer
    122470517 (MAPK1)
   05225 Hepatocellular carcinoma
    122470517 (MAPK1)
   05226 Gastric cancer
    122470517 (MAPK1)
   05214 Glioma
    122470517 (MAPK1)
   05216 Thyroid cancer
    122470517 (MAPK1)
   05221 Acute myeloid leukemia
    122470517 (MAPK1)
   05220 Chronic myeloid leukemia
    122470517 (MAPK1)
   05218 Melanoma
    122470517 (MAPK1)
   05211 Renal cell carcinoma
    122470517 (MAPK1)
   05219 Bladder cancer
    122470517 (MAPK1)
   05215 Prostate cancer
    122470517 (MAPK1)
   05213 Endometrial cancer
    122470517 (MAPK1)
   05224 Breast cancer
    122470517 (MAPK1)
   05223 Non-small cell lung cancer
    122470517 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122470517 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    122470517 (MAPK1)
   05161 Hepatitis B
    122470517 (MAPK1)
   05160 Hepatitis C
    122470517 (MAPK1)
   05171 Coronavirus disease - COVID-19
    122470517 (MAPK1)
   05164 Influenza A
    122470517 (MAPK1)
   05163 Human cytomegalovirus infection
    122470517 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122470517 (MAPK1)
   05165 Human papillomavirus infection
    122470517 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122470517 (MAPK1)
   05135 Yersinia infection
    122470517 (MAPK1)
   05133 Pertussis
    122470517 (MAPK1)
   05152 Tuberculosis
    122470517 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    122470517 (MAPK1)
   05140 Leishmaniasis
    122470517 (MAPK1)
   05142 Chagas disease
    122470517 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122470517 (MAPK1)
   05020 Prion disease
    122470517 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    122470517 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    122470517 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122470517 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122470517 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122470517 (MAPK1)
   04934 Cushing syndrome
    122470517 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122470517 (MAPK1)
   01524 Platinum drug resistance
    122470517 (MAPK1)
   01522 Endocrine resistance
    122470517 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbg01001]
    122470517 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbg03036]
    122470517 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbg04147]
    122470517 (MAPK1)
Enzymes [BR:pbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     122470517 (MAPK1)
Protein kinases [BR:pbg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   122470517 (MAPK1)
Chromosome and associated proteins [BR:pbg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     122470517 (MAPK1)
Exosome [BR:pbg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122470517 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 122470517
NCBI-ProteinID: XP_043414160
LinkDB
Position
D3:complement(29658701..29770752)
AA seq 362 aa
MAAAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISP
FEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKT
QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNP
HKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
RS
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtg
ttcgacgtggggccgcgctacaccaacctctcgtatatcggcgagggcgcctacggcatg
gtgtgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtcct
tttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttc
agacatgagaacatcattggaatcaatgatattattagagcaccaaccatcgagcaaatg
aaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagaca
caacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaa
tatatccattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaac
accacctgtgatctcaagatctgtgactttggcttggcccgcgttgcagatccagaccat
gatcacacagggttcctgacggagtacgtagccacacgttggtaccgggctccagaaatt
atgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcattctg
gcagagatgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaac
cacattctgggtattcttggatccccatcacaggaagacctgaattgtataataaattta
aaagctagaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctg
ttcccaaatgctgattccaaagctctggatttactggacaaaatgttgacgttcaaccct
cacaagaggattgaagtagaacaggctctggcccatccatatctggagcagtattacgac
ccaagtgatgagcccgtcgctgaggcaccgttcaagttcgacatggagctagacgacctg
cccaaggaaaagctcaaagagctcatcttcgaagagacggccaggttccagcccggatac
aggtcttaa

DBGET integrated database retrieval system