KEGG   Prionailurus bengalensis (leopard cat): 122472197
Entry
122472197         CDS       T07574                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
pbg  Prionailurus bengalensis (leopard cat)
Pathway
pbg04014  Ras signaling pathway
pbg04015  Rap1 signaling pathway
pbg04020  Calcium signaling pathway
pbg04022  cGMP-PKG signaling pathway
pbg04024  cAMP signaling pathway
pbg04070  Phosphatidylinositol signaling system
pbg04114  Oocyte meiosis
pbg04218  Cellular senescence
pbg04261  Adrenergic signaling in cardiomyocytes
pbg04270  Vascular smooth muscle contraction
pbg04371  Apelin signaling pathway
pbg04625  C-type lectin receptor signaling pathway
pbg04713  Circadian entrainment
pbg04720  Long-term potentiation
pbg04722  Neurotrophin signaling pathway
pbg04728  Dopaminergic synapse
pbg04740  Olfactory transduction
pbg04744  Phototransduction
pbg04750  Inflammatory mediator regulation of TRP channels
pbg04910  Insulin signaling pathway
pbg04912  GnRH signaling pathway
pbg04915  Estrogen signaling pathway
pbg04916  Melanogenesis
pbg04921  Oxytocin signaling pathway
pbg04922  Glucagon signaling pathway
pbg04924  Renin secretion
pbg04925  Aldosterone synthesis and secretion
pbg04970  Salivary secretion
pbg04971  Gastric acid secretion
pbg05010  Alzheimer disease
pbg05012  Parkinson disease
pbg05022  Pathways of neurodegeneration - multiple diseases
pbg05031  Amphetamine addiction
pbg05034  Alcoholism
pbg05133  Pertussis
pbg05152  Tuberculosis
pbg05163  Human cytomegalovirus infection
pbg05167  Kaposi sarcoma-associated herpesvirus infection
pbg05170  Human immunodeficiency virus 1 infection
pbg05200  Pathways in cancer
pbg05214  Glioma
pbg05417  Lipid and atherosclerosis
pbg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pbg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    122472197
   04015 Rap1 signaling pathway
    122472197
   04371 Apelin signaling pathway
    122472197
   04020 Calcium signaling pathway
    122472197
   04070 Phosphatidylinositol signaling system
    122472197
   04024 cAMP signaling pathway
    122472197
   04022 cGMP-PKG signaling pathway
    122472197
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    122472197
   04218 Cellular senescence
    122472197
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    122472197
  09152 Endocrine system
   04910 Insulin signaling pathway
    122472197
   04922 Glucagon signaling pathway
    122472197
   04912 GnRH signaling pathway
    122472197
   04915 Estrogen signaling pathway
    122472197
   04921 Oxytocin signaling pathway
    122472197
   04916 Melanogenesis
    122472197
   04924 Renin secretion
    122472197
   04925 Aldosterone synthesis and secretion
    122472197
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122472197
   04270 Vascular smooth muscle contraction
    122472197
  09154 Digestive system
   04970 Salivary secretion
    122472197
   04971 Gastric acid secretion
    122472197
  09156 Nervous system
   04728 Dopaminergic synapse
    122472197
   04720 Long-term potentiation
    122472197
   04722 Neurotrophin signaling pathway
    122472197
  09157 Sensory system
   04744 Phototransduction
    122472197
   04740 Olfactory transduction
    122472197
   04750 Inflammatory mediator regulation of TRP channels
    122472197
  09159 Environmental adaptation
   04713 Circadian entrainment
    122472197
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122472197
  09162 Cancer: specific types
   05214 Glioma
    122472197
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    122472197
   05163 Human cytomegalovirus infection
    122472197
   05167 Kaposi sarcoma-associated herpesvirus infection
    122472197
  09171 Infectious disease: bacterial
   05133 Pertussis
    122472197
   05152 Tuberculosis
    122472197
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122472197
   05012 Parkinson disease
    122472197
   05022 Pathways of neurodegeneration - multiple diseases
    122472197
  09165 Substance dependence
   05031 Amphetamine addiction
    122472197
   05034 Alcoholism
    122472197
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122472197
   05418 Fluid shear stress and atherosclerosis
    122472197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbg01009]
    122472197
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbg04131]
    122472197
   03036 Chromosome and associated proteins [BR:pbg03036]
    122472197
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbg04147]
    122472197
Protein phosphatases and associated proteins [BR:pbg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     122472197
Membrane trafficking [BR:pbg04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    122472197
Chromosome and associated proteins [BR:pbg03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     122472197
Exosome [BR:pbg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   122472197
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH EF_EFCAB10_C Dockerin_1 Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin SurA_N_3 DUF5580_M SurA_N_2
Other DBs
NCBI-GeneID: 122472197
NCBI-ProteinID: XP_043417422
LinkDB
Position
B4:4760819..4762119
AA seq 149 aa
MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG
NGSVDFPEFLGMMAQQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgacagaggaacaggtggctgagttcagggaggccttctgcctgttc
gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg
ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc
aacggctccgtggacttccccgagttcctgggcatgatggcccagcagctgaggggcagg
gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg
gtgagcgcggccgagctgcgacacgtgatgaccaggctcggggagaagctgagcgacgac
gaggtggacgagatgatccgggccgccgacgtggacggggacggccaggtcaactacgag
gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system