Prionailurus bengalensis (leopard cat): 122472197 Help Entry 122472197         CDS       T07574                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04014   Ras signaling pathway pbg04015   Rap1 signaling pathway pbg04020   Calcium signaling pathway pbg04022   cGMP-PKG signaling pathway pbg04024   cAMP signaling pathway pbg04070   Phosphatidylinositol signaling system pbg04114   Oocyte meiosis pbg04218   Cellular senescence pbg04261   Adrenergic signaling in cardiomyocytes pbg04270   Vascular smooth muscle contraction pbg04371   Apelin signaling pathway pbg04625   C-type lectin receptor signaling pathway pbg04713   Circadian entrainment pbg04720   Long-term potentiation pbg04722   Neurotrophin signaling pathway pbg04728   Dopaminergic synapse pbg04740   Olfactory transduction pbg04744   Phototransduction pbg04750   Inflammatory mediator regulation of TRP channels pbg04910   Insulin signaling pathway pbg04912   GnRH signaling pathway pbg04915   Estrogen signaling pathway pbg04916   Melanogenesis pbg04921   Oxytocin signaling pathway pbg04922   Glucagon signaling pathway pbg04924   Renin secretion pbg04925   Aldosterone synthesis and secretion pbg04970   Salivary secretion pbg04971   Gastric acid secretion pbg05010   Alzheimer disease pbg05012   Parkinson disease pbg05022   Pathways of neurodegeneration - multiple diseases pbg05031   Amphetamine addiction pbg05034   Alcoholism pbg05133   Pertussis pbg05152   Tuberculosis pbg05163   Human cytomegalovirus infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05170   Human immunodeficiency virus 1 infection pbg05200   Pathways in cancer pbg05214   Glioma pbg05417   Lipid and atherosclerosis pbg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122472197    04015 Rap1 signaling pathway     122472197    04371 Apelin signaling pathway     122472197    04020 Calcium signaling pathway     122472197    04070 Phosphatidylinositol signaling system     122472197    04024 cAMP signaling pathway     122472197    04022 cGMP-PKG signaling pathway     122472197  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122472197    04218 Cellular senescence     122472197  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122472197   09152 Endocrine system    04910 Insulin signaling pathway     122472197    04922 Glucagon signaling pathway     122472197    04912 GnRH signaling pathway     122472197    04915 Estrogen signaling pathway     122472197    04921 Oxytocin signaling pathway     122472197    04916 Melanogenesis     122472197    04924 Renin secretion     122472197    04925 Aldosterone synthesis and secretion     122472197   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122472197    04270 Vascular smooth muscle contraction     122472197   09154 Digestive system    04970 Salivary secretion     122472197    04971 Gastric acid secretion     122472197   09156 Nervous system    04728 Dopaminergic synapse     122472197    04720 Long-term potentiation     122472197    04722 Neurotrophin signaling pathway     122472197   09157 Sensory system    04744 Phototransduction     122472197    04740 Olfactory transduction     122472197    04750 Inflammatory mediator regulation of TRP channels     122472197   09159 Environmental adaptation    04713 Circadian entrainment     122472197  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122472197   09162 Cancer: specific types    05214 Glioma     122472197   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122472197    05163 Human cytomegalovirus infection     122472197    05167 Kaposi sarcoma-associated herpesvirus infection     122472197   09171 Infectious disease: bacterial    05133 Pertussis     122472197    05152 Tuberculosis     122472197   09164 Neurodegenerative disease    05010 Alzheimer disease     122472197    05012 Parkinson disease     122472197    05022 Pathways of neurodegeneration - multiple diseases     122472197   09165 Substance dependence    05031 Amphetamine addiction     122472197    05034 Alcoholism     122472197   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122472197    05418 Fluid shear stress and atherosclerosis     122472197  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pbg01009]     122472197   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122472197    03036 Chromosome and associated proteins [BR:pbg03036]     122472197   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122472197 Protein phosphatases and associated proteins [BR:pbg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122472197 Membrane trafficking [BR:pbg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122472197 Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122472197 Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122472197 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH EF_EFCAB10_C Dockerin_1 Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin SurA_N_3 DUF5580_M SurA_N_2 Motif Other DBs NCBI-GeneID:  122472197 NCBI-ProteinID:  XP_043417422 LinkDB All DBs Position B4:4760819..4762119 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMAQQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacagaggaacaggtggctgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc aacggctccgtggacttccccgagttcctgggcatgatggcccagcagctgaggggcagg gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcgacacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacgtggacggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system