Prionailurus bengalensis (leopard cat): 122473894 Help Entry 122473894         CDS       T07574                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04613   Neutrophil extracellular trap formation pbg05034   Alcoholism pbg05203   Viral carcinogenesis pbg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pbg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122473894  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122473894   09163 Immune disease    05322 Systemic lupus erythematosus     122473894   09165 Substance dependence    05034 Alcoholism     122473894  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbg03036]     122473894 Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122473894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  122473894 NCBI-ProteinID:  XP_043420665 LinkDB All DBs Position B4:complement(48290633..48290985) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgggaaaggcggcaaagggctgggaaaaggaggcgccaagcgccaccgg aaggtcttacgggacaacatccagggtattacgaagcccgccatccgccggctggcccgc cgagggggtgtcaagcgcatttcgggactcatctatgaggagacccggggagtacttaaa gtatttctggagaacgtgatccgcgatgcagtgacttacacggagcacgccaagcgcaag accgtcacggcaatggacgtggtgtacgcgttgaaacgccagggccgcacgttgtatggc ttcggtggctga

DBGET integrated database retrieval system