Prionailurus bengalensis (leopard cat): 122474263 Help Entry 122474263         CDS       T07574                                  Name (RefSeq) interferon alpha-like   KO K05414   interferon alpha Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04151   PI3K-Akt signaling pathway pbg04217   Necroptosis pbg04620   Toll-like receptor signaling pathway pbg04621   NOD-like receptor signaling pathway pbg04622   RIG-I-like receptor signaling pathway pbg04623   Cytosolic DNA-sensing pathway pbg04630   JAK-STAT signaling pathway pbg04650   Natural killer cell mediated cytotoxicity pbg04936   Alcoholic liver disease pbg05152   Tuberculosis pbg05160   Hepatitis C pbg05161   Hepatitis B pbg05162   Measles pbg05163   Human cytomegalovirus infection pbg05164   Influenza A pbg05165   Human papillomavirus infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05168   Herpes simplex virus 1 infection pbg05169   Epstein-Barr virus infection pbg05170   Human immunodeficiency virus 1 infection pbg05171   Coronavirus disease - COVID-19 pbg05200   Pathways in cancer pbg05320   Autoimmune thyroid disease pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122474263    04151 PI3K-Akt signaling pathway     122474263   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122474263  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122474263  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122474263    04621 NOD-like receptor signaling pathway     122474263    04622 RIG-I-like receptor signaling pathway     122474263    04623 Cytosolic DNA-sensing pathway     122474263    04650 Natural killer cell mediated cytotoxicity     122474263  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122474263   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122474263    05161 Hepatitis B     122474263    05160 Hepatitis C     122474263    05171 Coronavirus disease - COVID-19     122474263    05164 Influenza A     122474263    05162 Measles     122474263    05168 Herpes simplex virus 1 infection     122474263    05163 Human cytomegalovirus infection     122474263    05167 Kaposi sarcoma-associated herpesvirus infection     122474263    05169 Epstein-Barr virus infection     122474263    05165 Human papillomavirus infection     122474263   09171 Infectious disease: bacterial    05152 Tuberculosis     122474263   09163 Immune disease    05320 Autoimmune thyroid disease     122474263   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122474263   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122474263  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122474263 Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Interferons    122474263 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122474263 NCBI-ProteinID:  XP_043421046 LinkDB All DBs Position D4:complement(45646085..45646777) Genome browser AA seq 189 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVAHVTNQKIFHFFCTGASSSAAWNTTLLEEFCTGLDRQLTRL EACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTA LQKRLRSEK NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tccctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgccagaaggacagaaacgacttcgcc ttcccccaggacgtgtttggtggagaccagtcccacaaggcccaagccctctcggtggcc cacgtgacgaaccagaagatcttccacttcttctgcacaggggcttcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattattcatcaacagcc ttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system