Prionailurus bengalensis (leopard cat): 122474333 Help Entry 122474333         CDS       T07574                                  Name (RefSeq) interferon alpha   KO K05414   interferon alpha Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04151   PI3K-Akt signaling pathway pbg04217   Necroptosis pbg04620   Toll-like receptor signaling pathway pbg04621   NOD-like receptor signaling pathway pbg04622   RIG-I-like receptor signaling pathway pbg04623   Cytosolic DNA-sensing pathway pbg04630   JAK-STAT signaling pathway pbg04650   Natural killer cell mediated cytotoxicity pbg04936   Alcoholic liver disease pbg05152   Tuberculosis pbg05160   Hepatitis C pbg05161   Hepatitis B pbg05162   Measles pbg05163   Human cytomegalovirus infection pbg05164   Influenza A pbg05165   Human papillomavirus infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05168   Herpes simplex virus 1 infection pbg05169   Epstein-Barr virus infection pbg05170   Human immunodeficiency virus 1 infection pbg05171   Coronavirus disease - COVID-19 pbg05200   Pathways in cancer pbg05320   Autoimmune thyroid disease pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122474333    04151 PI3K-Akt signaling pathway     122474333   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122474333  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122474333  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122474333    04621 NOD-like receptor signaling pathway     122474333    04622 RIG-I-like receptor signaling pathway     122474333    04623 Cytosolic DNA-sensing pathway     122474333    04650 Natural killer cell mediated cytotoxicity     122474333  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122474333   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122474333    05161 Hepatitis B     122474333    05160 Hepatitis C     122474333    05171 Coronavirus disease - COVID-19     122474333    05164 Influenza A     122474333    05162 Measles     122474333    05168 Herpes simplex virus 1 infection     122474333    05163 Human cytomegalovirus infection     122474333    05167 Kaposi sarcoma-associated herpesvirus infection     122474333    05169 Epstein-Barr virus infection     122474333    05165 Human papillomavirus infection     122474333   09171 Infectious disease: bacterial    05152 Tuberculosis     122474333   09163 Immune disease    05320 Autoimmune thyroid disease     122474333   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122474333   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122474333  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122474333 Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Interferons    122474333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122474333 NCBI-ProteinID:  XP_043421144 LinkDB All DBs Position D4:45771001..45771762 Genome browser AA seq 194 aa AA seqDB search MALPSSFLVALVALGCNSICSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVAHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDWQLTRL EACVVQEVGEGEAPLTNEDVHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY YSSTALQKRLRSEK NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccatctgc tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgccagaaggacagaaacgacttcgcc ttcccccaggacgtgtttggtggagaccagtcccacaaggcccaagccctttcggtggcc cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgattggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggacgtt catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tattcatcaacagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system