Prionailurus bengalensis (leopard cat): 122478804 Help Entry 122478804         CDS       T07574                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04061   Viral protein interaction with cytokine and cytokine receptor pbg04062   Chemokine signaling pathway pbg04064   NF-kappa B signaling pathway pbg04072   Phospholipase D signaling pathway pbg04218   Cellular senescence pbg04620   Toll-like receptor signaling pathway pbg04621   NOD-like receptor signaling pathway pbg04622   RIG-I-like receptor signaling pathway pbg04657   IL-17 signaling pathway pbg04932   Non-alcoholic fatty liver disease pbg04933   AGE-RAGE signaling pathway in diabetic complications pbg04936   Alcoholic liver disease pbg05132   Salmonella infection pbg05133   Pertussis pbg05134   Legionellosis pbg05135   Yersinia infection pbg05142   Chagas disease pbg05144   Malaria pbg05146   Amoebiasis pbg05161   Hepatitis B pbg05163   Human cytomegalovirus infection pbg05164   Influenza A pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05171   Coronavirus disease - COVID-19 pbg05200   Pathways in cancer pbg05202   Transcriptional misregulation in cancer pbg05219   Bladder cancer pbg05323   Rheumatoid arthritis pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     122478804 (CXCL8)    04072 Phospholipase D signaling pathway     122478804 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122478804 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     122478804 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     122478804 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122478804 (CXCL8)    04621 NOD-like receptor signaling pathway     122478804 (CXCL8)    04622 RIG-I-like receptor signaling pathway     122478804 (CXCL8)    04657 IL-17 signaling pathway     122478804 (CXCL8)    04062 Chemokine signaling pathway     122478804 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122478804 (CXCL8)    05202 Transcriptional misregulation in cancer     122478804 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     122478804 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     122478804 (CXCL8)    05171 Coronavirus disease - COVID-19     122478804 (CXCL8)    05164 Influenza A     122478804 (CXCL8)    05163 Human cytomegalovirus infection     122478804 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     122478804 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     122478804 (CXCL8)    05135 Yersinia infection     122478804 (CXCL8)    05133 Pertussis     122478804 (CXCL8)    05134 Legionellosis     122478804 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     122478804 (CXCL8)    05144 Malaria     122478804 (CXCL8)    05142 Chagas disease     122478804 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     122478804 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122478804 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122478804 (CXCL8)    04932 Non-alcoholic fatty liver disease     122478804 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     122478804 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122478804 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:pbg00536]     122478804 (CXCL8) Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Chemokines    122478804 (CXCL8) Glycosaminoglycan binding proteins [BR:pbg00536]  Heparan sulfate / Heparin   Chemokines    122478804 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  122478804 NCBI-ProteinID:  XP_043428420 LinkDB All DBs Position B1:complement(146558594..146562277) Genome browser AA seq 101 aa AA seqDB search MTSKLVVALLAAFMLSAALCEAAVVSRMSSELRCQCIKTHSTPFNPKLIKELTVIDSGPH CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt gaagctgcagttgtgtcaagaatgagttcagaacttcgatgccagtgcataaaaactcat tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat gcataa

DBGET integrated database retrieval system