Prionailurus bengalensis (leopard cat): 122479809 Help Entry 122479809         CDS       T07574                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04014   Ras signaling pathway pbg04015   Rap1 signaling pathway pbg04020   Calcium signaling pathway pbg04022   cGMP-PKG signaling pathway pbg04024   cAMP signaling pathway pbg04070   Phosphatidylinositol signaling system pbg04114   Oocyte meiosis pbg04218   Cellular senescence pbg04261   Adrenergic signaling in cardiomyocytes pbg04270   Vascular smooth muscle contraction pbg04371   Apelin signaling pathway pbg04625   C-type lectin receptor signaling pathway pbg04713   Circadian entrainment pbg04720   Long-term potentiation pbg04722   Neurotrophin signaling pathway pbg04728   Dopaminergic synapse pbg04740   Olfactory transduction pbg04744   Phototransduction pbg04750   Inflammatory mediator regulation of TRP channels pbg04910   Insulin signaling pathway pbg04912   GnRH signaling pathway pbg04915   Estrogen signaling pathway pbg04916   Melanogenesis pbg04921   Oxytocin signaling pathway pbg04922   Glucagon signaling pathway pbg04924   Renin secretion pbg04925   Aldosterone synthesis and secretion pbg04970   Salivary secretion pbg04971   Gastric acid secretion pbg05010   Alzheimer disease pbg05012   Parkinson disease pbg05022   Pathways of neurodegeneration - multiple diseases pbg05031   Amphetamine addiction pbg05034   Alcoholism pbg05133   Pertussis pbg05152   Tuberculosis pbg05163   Human cytomegalovirus infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05170   Human immunodeficiency virus 1 infection pbg05200   Pathways in cancer pbg05214   Glioma pbg05417   Lipid and atherosclerosis pbg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122479809 (CALML6)    04015 Rap1 signaling pathway     122479809 (CALML6)    04371 Apelin signaling pathway     122479809 (CALML6)    04020 Calcium signaling pathway     122479809 (CALML6)    04070 Phosphatidylinositol signaling system     122479809 (CALML6)    04024 cAMP signaling pathway     122479809 (CALML6)    04022 cGMP-PKG signaling pathway     122479809 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122479809 (CALML6)    04218 Cellular senescence     122479809 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122479809 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     122479809 (CALML6)    04922 Glucagon signaling pathway     122479809 (CALML6)    04912 GnRH signaling pathway     122479809 (CALML6)    04915 Estrogen signaling pathway     122479809 (CALML6)    04921 Oxytocin signaling pathway     122479809 (CALML6)    04916 Melanogenesis     122479809 (CALML6)    04924 Renin secretion     122479809 (CALML6)    04925 Aldosterone synthesis and secretion     122479809 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122479809 (CALML6)    04270 Vascular smooth muscle contraction     122479809 (CALML6)   09154 Digestive system    04970 Salivary secretion     122479809 (CALML6)    04971 Gastric acid secretion     122479809 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     122479809 (CALML6)    04720 Long-term potentiation     122479809 (CALML6)    04722 Neurotrophin signaling pathway     122479809 (CALML6)   09157 Sensory system    04744 Phototransduction     122479809 (CALML6)    04740 Olfactory transduction     122479809 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     122479809 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     122479809 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122479809 (CALML6)   09162 Cancer: specific types    05214 Glioma     122479809 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122479809 (CALML6)    05163 Human cytomegalovirus infection     122479809 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     122479809 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     122479809 (CALML6)    05152 Tuberculosis     122479809 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     122479809 (CALML6)    05012 Parkinson disease     122479809 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     122479809 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     122479809 (CALML6)    05034 Alcoholism     122479809 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122479809 (CALML6)    05418 Fluid shear stress and atherosclerosis     122479809 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pbg01009]     122479809 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122479809 (CALML6)    03036 Chromosome and associated proteins [BR:pbg03036]     122479809 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122479809 (CALML6) Protein phosphatases and associated proteins [BR:pbg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122479809 (CALML6) Membrane trafficking [BR:pbg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122479809 (CALML6) Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122479809 (CALML6) Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122479809 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  122479809 NCBI-ProteinID:  XP_043429500 LinkDB All DBs Position C1:813013..815131 Genome browser AA seq 156 aa AA seqDB search MTERLTAEQIKEYKGVFEMFDEEGNGEVKTAELERLMSLLGINPTKSELASMAKDVDRDN KGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNE VEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgacggagcgcctgacggccgagcagatcaaggagtacaagggcgtctttgagatgttc gacgaggagggcaacggggaggtgaagacggcagagctggagcggctcatgagcctgctg ggcatcaaccccaccaagagcgagctggcttccatggccaaggacgtggacagagacaac aaaggattcttcaactgtgacagcttcctggccctgatggggatttactgggagaaggcc cagaaccaggagggcgagctgagggcagccttccgtgtcttcgacaaggagggcaagggc tacatcgactggaacacgcttaagtacgtgctcatgaacgcaggtgagcccctcaatgag gtagaggccgagcagatgatgaaggaggctgacaaggacggagacggaaccattgactac gaggagtttgtggccatgatgaccggagagtccttcaagctggtccagtag

DBGET integrated database retrieval system