Prionailurus bengalensis (leopard cat): 122480538 Help Entry 122480538         CDS       T07574                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04010   MAPK signaling pathway pbg04014   Ras signaling pathway pbg04015   Rap1 signaling pathway pbg04020   Calcium signaling pathway pbg04151   PI3K-Akt signaling pathway pbg04810   Regulation of actin cytoskeleton pbg05200   Pathways in cancer pbg05207   Chemical carcinogenesis - receptor activation pbg05218   Melanoma pbg05224   Breast cancer pbg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122480538 (FGF9)    04014 Ras signaling pathway     122480538 (FGF9)    04015 Rap1 signaling pathway     122480538 (FGF9)    04020 Calcium signaling pathway     122480538 (FGF9)    04151 PI3K-Akt signaling pathway     122480538 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122480538 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122480538 (FGF9)    05207 Chemical carcinogenesis - receptor activation     122480538 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     122480538 (FGF9)    05218 Melanoma     122480538 (FGF9)    05224 Breast cancer     122480538 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122480538 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:pbg00536]     122480538 (FGF9) Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Growth factors (RTK binding)    122480538 (FGF9) Glycosaminoglycan binding proteins [BR:pbg00536]  Heparan sulfate / Heparin   Growth factors/receptors    122480538 (FGF9) SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  122480538 NCBI-ProteinID:  XP_043431005 LinkDB All DBs Position A1:2480193..2515063 Genome browser AA seq 208 aa AA seqDB search MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccatttggg aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc gaagcaggggggcttcccaggggacccgcagtcacggacctggatcatttaaaggggatt ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt gaagaaaactggtataacacctactcttcgaatctctataaacacgtggacactggaagg cgatactacgttgcgttaaacaaagacgggacccccagagaaggaaccaggactaaacgg caccagaaattcacacattttttacccagaccagtggaccccgacaaagtacccgaacta tataaggatattctaagccaaagttga

DBGET integrated database retrieval system