Prionailurus bengalensis (leopard cat): 122481099 Help Entry 122481099         CDS       T07574                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04613   Neutrophil extracellular trap formation pbg05034   Alcoholism pbg05203   Viral carcinogenesis pbg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pbg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122481099  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122481099   09163 Immune disease    05322 Systemic lupus erythematosus     122481099   09165 Substance dependence    05034 Alcoholism     122481099  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbg03036]     122481099   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122481099 Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122481099 Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122481099 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  122481099 NCBI-ProteinID:  XP_043432039 LinkDB All DBs Position C1:complement(105193865..105196127) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcaaaatccgctcccgcgcccaagaagggctcgaaaaaggcggtcacc aaagcccagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacactggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaatgacatctttgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcaaccatcacgtcccgggagatccagacggctgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system