Prionailurus bengalensis (leopard cat): 122484127 Help Entry 122484127         CDS       T07574                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04010   MAPK signaling pathway pbg04014   Ras signaling pathway pbg04015   Rap1 signaling pathway pbg04022   cGMP-PKG signaling pathway pbg04066   HIF-1 signaling pathway pbg04068   FoxO signaling pathway pbg04072   Phospholipase D signaling pathway pbg04081   Hormone signaling pbg04114   Oocyte meiosis pbg04140   Autophagy - animal pbg04150   mTOR signaling pathway pbg04151   PI3K-Akt signaling pathway pbg04152   AMPK signaling pathway pbg04211   Longevity regulating pathway pbg04213   Longevity regulating pathway - multiple species pbg04810   Regulation of actin cytoskeleton pbg04910   Insulin signaling pathway pbg04911   Insulin secretion pbg04913   Ovarian steroidogenesis pbg04914   Progesterone-mediated oocyte maturation pbg04917   Prolactin signaling pathway pbg04923   Regulation of lipolysis in adipocytes pbg04930   Type II diabetes mellitus pbg04931   Insulin resistance pbg04932   Non-alcoholic fatty liver disease pbg04940   Type I diabetes mellitus pbg04950   Maturity onset diabetes of the young pbg04960   Aldosterone-regulated sodium reabsorption pbg05010   Alzheimer disease pbg05215   Prostate cancer pbg05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122484127 (INS)    04014 Ras signaling pathway     122484127 (INS)    04015 Rap1 signaling pathway     122484127 (INS)    04066 HIF-1 signaling pathway     122484127 (INS)    04068 FoxO signaling pathway     122484127 (INS)    04072 Phospholipase D signaling pathway     122484127 (INS)    04022 cGMP-PKG signaling pathway     122484127 (INS)    04151 PI3K-Akt signaling pathway     122484127 (INS)    04152 AMPK signaling pathway     122484127 (INS)    04150 mTOR signaling pathway     122484127 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     122484127 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122484127 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     122484127 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122484127 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     122484127 (INS)    04910 Insulin signaling pathway     122484127 (INS)    04923 Regulation of lipolysis in adipocytes     122484127 (INS)    04913 Ovarian steroidogenesis     122484127 (INS)    04914 Progesterone-mediated oocyte maturation     122484127 (INS)    04917 Prolactin signaling pathway     122484127 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     122484127 (INS)   09149 Aging    04211 Longevity regulating pathway     122484127 (INS)    04213 Longevity regulating pathway - multiple species     122484127 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     122484127 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     122484127 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     122484127 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     122484127 (INS)    04940 Type I diabetes mellitus     122484127 (INS)    04950 Maturity onset diabetes of the young     122484127 (INS)    04932 Non-alcoholic fatty liver disease     122484127 (INS)    04931 Insulin resistance     122484127 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122484127 (INS) Cytokines and neuropeptides [BR:pbg04052]  Neuropeptides   Unclassified    122484127 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  122484127 NCBI-ProteinID:  XP_043437955 LinkDB All DBs Position D1:114369240..114377645 Genome browser AA seq 110 aa AA seqDB search MALWTRLLPLLALLCLWTPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED LQGKDAELGEAPGAGGLQPSALEAPLQKRGIVEQCCASVCSLYQLEHYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctggcgctgctgtgcctctggacccctgcc ccgacccgagccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgtggcttcttctacacgcccaaggcccgccgggaggcggaggac cttcaggggaaggacgcggagctgggggaggcgcctggcgccggcggcctgcagccctcg gccctggaggcgcccctgcagaagcggggcatcgtggagcaatgctgtgccagcgtctgc tcgctgtaccagctggagcattactgcaactag

DBGET integrated database retrieval system