Prionailurus bengalensis (leopard cat): 122484295 Help Entry 122484295         CDS       T07574                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04360   Axon guidance pbg04666   Fc gamma R-mediated phagocytosis pbg04810   Regulation of actin cytoskeleton pbg05133   Pertussis pbg05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:pbg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122484295  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     122484295   09158 Development and regeneration    04360 Axon guidance     122484295  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122484295   09171 Infectious disease: bacterial    05133 Pertussis     122484295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122484295   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbg04812]     122484295    04147 Exosome [BR:pbg04147]     122484295 Membrane trafficking [BR:pbg04131]  Others   Actin-binding proteins    Others     122484295 Cytoskeleton proteins [BR:pbg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      122484295 Exosome [BR:pbg04147]  Exosomal proteins   Proteins found in most exosomes    122484295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  122484295 NCBI-ProteinID:  XP_043438207 LinkDB All DBs Position D1:complement(77994195..77994712) Genome browser AA seq 144 aa AA seqDB search MKVQNSSTPEEVKKRKKAVLFCLSKDKKSIILEEGKEILVSDVGQTVDDPYAIFVKLLPD KDCCYALCDAPYQTKESKKEDLVFIFRARECAPLKSKVIYTSSKDAIKKKLTGIKCELQA NCYEEVKDQCTLAEKLGGSASSPL NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgaaggttcaaaattcctcaacaccagaggaggtgaagaagcgcaagaaggcggtactc ttctgcctgagcaaagacaagaagagcatcatcctggaggagggcaaggagatcctggtg agtgatgtgggccagaccgtagacgacccctatgccatctttgtcaagttgctgccagac aaggactgctgctatgccctctgtgatgccccctaccagaccaaggagagcaagaaggag gacctggtgtttatcttccgggcacgtgaatgtgcaccccttaagagcaaagtgatttat accagctccaaggacgccatcaagaagaagctgacagggatcaagtgtgaattacaagca aactgctacgaggaggtcaaggaccagtgtaccctggccgagaaattggggggcagtgcc tcatctcctttgtga

DBGET integrated database retrieval system