Prionailurus bengalensis (leopard cat): 122484751 Help Entry 122484751         CDS       T07574                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04081   Hormone signaling pbg04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     122484751 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     122484751 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122484751 (GAST) Cytokines and neuropeptides [BR:pbg04052]  Neuropeptides   GPCR binding    122484751 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  122484751 NCBI-ProteinID:  XP_043438627 LinkDB All DBs Position E1:40223150..40224207 Genome browser AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system