Prionailurus bengalensis (leopard cat): 122485249
Help
Entry
122485249 CDS
T07574
Name
(RefSeq) C-C motif chemokine 23-like
KO
K05511
C-C motif chemokine 15/23
Organism
pbg
Prionailurus bengalensis (leopard cat)
Pathway
pbg04060
Cytokine-cytokine receptor interaction
pbg04061
Viral protein interaction with cytokine and cytokine receptor
pbg04062
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:
pbg00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
122485249
04061 Viral protein interaction with cytokine and cytokine receptor
122485249
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
122485249
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
pbg04052
]
122485249
Cytokines and neuropeptides [BR:
pbg04052
]
Cytokines
Chemokines
122485249
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
IL8
Motif
Other DBs
NCBI-GeneID:
122485249
NCBI-ProteinID:
XP_043439678
LinkDB
All DBs
Position
E1:complement(23125588..23129669)
Genome browser
AA seq
107 aa
AA seq
DB search
MKVFAAALPFLIVATAFGAQVQALHEPMVAIRPHETSIHLQGFHRPSDCCTHYTPRKIRC
GFMEDYYETSSGCSQPGVIFLTKKGQRVCANPFDLGVQNCVRSLKSN
NT seq
324 nt
NT seq
+upstream
nt +downstream
nt
atgaaggtcttcgcagctgccctccccttcctcattgttgctactgcctttggagcccag
gtccaggcccttcatgaacccatggtggcaatacgtccgcatgaaacctcgatacatctg
caaggctttcaccgtccctctgactgctgcacccactacactccacggaaaatccgatgt
ggattcatggaagattactatgaaacaagcagcgggtgctcccagccaggtgtcatcttc
ctcaccaagaaggggcagcgtgtctgtgccaacccctttgatttgggagttcagaattgc
gtgaggtccctgaagtcgaactaa
DBGET
integrated database retrieval system