Prionailurus bengalensis (leopard cat): 122485251 Help Entry 122485251         CDS       T07574                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04061   Viral protein interaction with cytokine and cytokine receptor pbg04062   Chemokine signaling pathway pbg04620   Toll-like receptor signaling pathway pbg05142   Chagas disease pbg05163   Human cytomegalovirus infection pbg05323   Rheumatoid arthritis pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122485251    04061 Viral protein interaction with cytokine and cytokine receptor     122485251  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122485251    04062 Chemokine signaling pathway     122485251  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     122485251   09174 Infectious disease: parasitic    05142 Chagas disease     122485251   09163 Immune disease    05323 Rheumatoid arthritis     122485251   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122485251  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122485251    00536 Glycosaminoglycan binding proteins [BR:pbg00536]     122485251 Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Chemokines    122485251 Glycosaminoglycan binding proteins [BR:pbg00536]  Heparan sulfate / Heparin   Chemokines    122485251 SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  122485251 NCBI-ProteinID:  XP_043439681 LinkDB All DBs Position E1:complement(23196549..23198446) Genome browser AA seq 93 aa AA seqDB search MKVPGASLAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccggggcttccctcgccatcctcctctgcaccatggccctctgcagtcag gtcttctctgcaccatttggagctgacaccccaactgcctgctgcttctcctatgtctcc aagcagattccacgcaagttcatagccgactattttgagaccagcagccaatgctccaag ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc tgggtccaggaatatgtgactgacttggagctgagtgcctga

DBGET integrated database retrieval system