Prionailurus bengalensis (leopard cat): 122487241 Help Entry 122487241         CDS       T07574                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04630   JAK-STAT signaling pathway pbg04640   Hematopoietic cell lineage pbg04657   IL-17 signaling pathway pbg04658   Th1 and Th2 cell differentiation pbg04660   T cell receptor signaling pathway pbg04664   Fc epsilon RI signaling pathway pbg04672   Intestinal immune network for IgA production pbg05200   Pathways in cancer pbg05310   Asthma pbg05320   Autoimmune thyroid disease pbg05321   Inflammatory bowel disease pbg05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122487241 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122487241 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122487241 (IL5)    04660 T cell receptor signaling pathway     122487241 (IL5)    04658 Th1 and Th2 cell differentiation     122487241 (IL5)    04657 IL-17 signaling pathway     122487241 (IL5)    04664 Fc epsilon RI signaling pathway     122487241 (IL5)    04672 Intestinal immune network for IgA production     122487241 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122487241 (IL5)   09163 Immune disease    05310 Asthma     122487241 (IL5)    05320 Autoimmune thyroid disease     122487241 (IL5)    05321 Inflammatory bowel disease     122487241 (IL5)    05330 Allograft rejection     122487241 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122487241 (IL5)    00536 Glycosaminoglycan binding proteins [BR:pbg00536]     122487241 (IL5) Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Interleukins    122487241 (IL5) Glycosaminoglycan binding proteins [BR:pbg00536]  Heparan sulfate / Heparin   Cytokines    122487241 (IL5) SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  122487241 NCBI-ProteinID:  XP_043443295 LinkDB All DBs Position A1:complement(110007373..110009513) Genome browser AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNRTVPGDAVEKLFRNLSLIKEHIDHQKKKCGGERWKVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgtaccg ggggatgctgtggaaaagcttttccgaaacttgtctttaataaaagaacacatagaccac caaaaaaaaaagtgtggaggagaaagatggaaagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system